KEGG   Sinomonas atrocyanea: SA2016_3583Help
Entry
SA2016_3583       CDS       T04286                                 

Definition
(GenBank) Phosphoesterase family
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
satk  Sinomonas atrocyanea
Pathway
satk00562  Inositol phosphate metabolism
satk00564  Glycerophospholipid metabolism
satk01100  Metabolic pathways
satk01110  Biosynthesis of secondary metabolites
satk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:satk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SA2016_3583
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SA2016_3583
   00565 Ether lipid metabolism
    SA2016_3583
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SA2016_3583
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:satk02042]
    SA2016_3583
Enzymes [BR:satk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SA2016_3583
Bacterial toxins [BR:satk02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SA2016_3583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AMM34241
UniProt: A0A127A5Q0
Position
3867496..3868827
Genome map
AA seq 443 aa AA seqDB search
MADGLAGIDHIVVLMLENRSFDHVLGYLYHAAGNVSPSGAPFEGLTGTESCPGPDGKPVA
VYPITPTTPDAYFMPGADPGEGFARANAQLFGTTKPAPGAVPTMTGFVSDYAQAIKDNQA
KKWYVVPGTAPGWIMGCFAPETLPVLSGLARGFAVCDHWFSSVPTETMPNRAFTCAGTSQ
GHMDDVTKSFTVPSIFGLLGQHGVPWKIYGYSKPPLTRLNFPDTQKAPAANIGLFKDFRA
DAAAGTLPAFAFVEPAWSSTGNSQHPNYSMAAGEQLILDTYSALRAGPAWARTLLIVTYD
EHGGCYDHVPPPGGAVRPDDSPGEFGFDFTRFGPRVPTVLVSPLIPPGTVFRVPAGSTPL
DHTSILATVEHRFGLPPLTRRDAAAPDVGAVLTLATPRSDDPLAGVSAPPQPPVPAALAA
TPAHLADVRDELMARFTPGDVVG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggactcgcaggaatcgaccacatcgtggtgctcatgctcgagaaccgctcg
ttcgaccacgtgctcgggtacctctaccacgccgcggggaacgtgtcgccgagcggggcg
ccgttcgagggcctcacaggcaccgaaagctgcccgggccccgatggcaagcccgtggcg
gtctaccccatcactccgacgacccccgacgcctacttcatgcctggggccgacccgggt
gagggcttcgcgcgggccaacgcccagctcttcgggaccacgaagcccgctccgggagcg
gtgcccaccatgaccgggttcgtgtccgactacgcgcaggccatcaaggacaaccaggcg
aagaagtggtacgtggtccccggcacggcgccgggctggatcatgggctgcttcgccccg
gagacgctccccgtgctcagcgggctcgcgcgcgggttcgccgtgtgcgaccactggttc
agctccgtgcccacagagaccatgcccaaccgggccttcacgtgcgccgggacgagccag
ggccacatggacgacgtcacgaagtcgttcaccgtgccgagcatcttcgggctcctcggc
cagcacggcgtgccgtggaagatctacggctacagcaagccgccgctgacccgtctgaac
tttccggacacgcagaaggccccggcggcgaacatcggcctgttcaaggacttccgcgcc
gacgccgcggcagggaccttgcccgcgttcgccttcgtggagccggcctggagttccacc
ggcaacagccagcaccccaactacagcatggccgcaggggagcagctcatcctcgacacc
tacagcgcactccgcgcggggccggcctgggcgaggacgctcctgatcgtgacctatgac
gagcacggcggatgctacgaccacgtcccgccgcccggcggggcggtccggccggacgac
tcgccgggagagttcggattcgacttcacgcgcttcggcccccgggtccccacggtcctg
gtgagcccgctcatcccgcccggcacggtgttccgcgtgcccgcgggatccacgcccctc
gaccacacgagcatcctggccaccgtggaacaccggttcgggctgccgccgctcacccgc
agggacgcggccgcgccggacgtcggggccgtcctcacgctcgccacaccccggagcgac
gaccccctggccggggtctcggcgccgccgcagcctcccgtccccgcagccctggcggcc
acgcccgcgcatctggcggacgtccgggacgagctcatggcgcgcttcacgccgggggac
gtggtgggctga

DBGET integrated database retrieval system