KEGG   Sinomonas atrocyanea: SA2016_3615Help
Entry
SA2016_3615       CDS       T04286                                 

Definition
(GenBank) phosphoribosyltransferase
Organism
satk  Sinomonas atrocyanea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRTase_1 PRTase_2 TRSP PELOTA_1 Pribosyltran
Motif
Other DBs
NCBI-ProteinID: AMM34273
UniProt: A0A127A4M0
Position
3904924..3908499
Genome map
AA seq 1191 aa AA seqDB search
MTDTAEVTPLDRDVTPPEREWPGTVVRDRLGIILTTAPGSLLPVDALVGLAVRRNPKRAQ
LLVSRVLAKHVPTPPAVALGAARLLGAAVARELGLGPAGGAAPGPPLEEAARALLARLAG
DAPSDAQPLRLPAPPAGGEQIATLGYAETATGLGHAVAEHLGSYYLHSTRLSTPVRPFGG
FEEEHSHATGHTLVPGDPTRLARAATVVLVDDELSTGRTVLNTVRELHAAWRPRTTHDAG
PSGAAPPRRRYVVATLVDLRGAEDRAEFERLAGELGCGLTVVALGEGSVSLPADVLARAA
HWLAESPGPDLARPRADLTRPQGHLAHPWGDLGAVRSARFGVDTAGPHGVRLADLAAPAA
RAAAAALAGKGLPRTARVLVLGAEEHLALPLAVADALTADFPGTLFSSTTRSPVHVHDEP
GYAVRSALTFSSHDHALDGAPGTGRRHAYNVVTAGERFDAIVYVPEPGTAPEDLSMAGLP
GTGAHGEPSVTEALARAAGTVVVLHLGAEPAYPEPLRGGTHPGAFGSYPPEDVGWLLKDL
SGARLEAPAHEREAAIQSGRASYAESLPQEYEPSPEYQALFREALAASGARIAQAVADVT
EQVLALRGREPVLVSLARAGTPVGVLMRRWAAHAHGLDVPHYTMSIVRGLGIDANALRWL
LTRHRPEQIMFVDGWTGKGAITRELAAALEDFANSDGVRLSPELAVLADPGQCVRVSGTR
DDFLIPSACLNSTVSGLVSRTVFNRALIGPHETHGAKFYRELAPRDVSNEFVDAVAARFP
DIRPGLPGPLTAPTWAGWAAVERIAAEQGLGPLRSAVNLVKPGVGETTRVLLRRVPWKVL
ARPELLATDDAGRLLCGDLAHVLLLAAQRGCRWSRQRGCRTAAWGSSTRASRPARRAPTG
RRWPMSRTVVACDLDRTLIYSARALHLEGPDRDAPRLVVSEVYENAPLSYMTRAAEDLLH
ELLGRAVLVPVTTRTQAQFARVQLPATPYAITTNGGVLLHGGTPDGAWSARVRGAVARGS
APIGEVLARVCENAPPWVDRVRTAEDLFAYAIVDRAALPAGWLADLSGWCAGRGWVVSLQ
GRKLYCVPSAVTKESAVAEVMERVGASGLVAAGDSLLDRGLLELADLPLRPRHGELEDAG
YTRPGLRVTESAGVLAGEEILRAALEAATVPSGPQAAGAEASLAHSSAMRR
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaccgccgaggtcacccccctggaccgcgacgtcaccccgccggagcgcgag
tggcccgggaccgtggtccgcgaccggctcgggatcatcctgacgacggcgcccggcagc
ctcctgcccgtcgacgcgctcgtgggcctcgcggtgcggcgcaaccccaagcgcgcccag
ctgctcgtctcgcgcgtcctcgccaagcacgtgcccactccgccggcggtcgcgctcggc
gccgcgcggctcctcggcgcggccgtggcccgcgagctggggctcggccccgccggcggc
gccgcccccggcccccctctggaggaggccgcccgggcgctcctggcccgcctcgccggg
gacgcgccgtcggacgcgcagcccctccgcttgcccgcgccgcccgccggcggcgagcag
atcgcgaccctcggctacgccgagaccgccaccggcctggggcacgccgtcgccgagcac
ctcggctcgtactacctccactccacccggctgagcacgcccgtacgtcccttcggcggc
ttcgaggaggagcactcgcacgcgaccgggcacaccctcgtgcccggcgaccccacccgg
ctcgcccgcgccgccacggtggtgctggtcgacgacgagctctccaccggccgcacggtc
ctcaacacggtgcgggagctgcacgccgcgtggcgcccgcggacaacgcacgacgccggc
ccctccggcgcggcgccgcctcgccggcggtacgtggtcgccaccctggtcgacctccgc
ggcgccgaggaccgcgccgagttcgagcggctcgccggggagctcggatgcgggctgacg
gtcgtggcgctcggggagggctcggtctcgctgcctgccgacgtcctcgccagggccgcg
cactggctggccgagtcccccggccccgacctcgcgcgcccacgggctgacctcacgcgc
ccacaggggcacctcgcgcacccatggggtgacctcggcgcggtgcggagcgcccggttc
ggcgtcgacacggcgggcccgcacggggtccggctcgccgacctggccgcccccgccgcg
cgcgccgcggcggccgcccttgccgggaaggggctcccgcggacggcccgggtcctggtc
ctcggcgcggaggagcacctcgcgctgcccctcgccgtcgccgacgccctcaccgccgac
ttcccgggcaccctcttctcctcgaccacccgctccccggtacacgtccacgacgagccg
ggctacgcggtccgctcggcgctcacgttctcctcccacgaccacgccctcgacggcgcc
ccgggcaccggccgccgccacgcgtacaacgtcgtgaccgccggcgagcgcttcgatgcc
atcgtctacgtgcccgagcccggcacggcgcccgaggacctctccatggcgggcctgccc
ggcaccggggcccacggcgagcccagtgtcaccgaggccctcgcgcgggcggcgggcacc
gtcgtcgtgctccacctcggggccgagccggcgtacccggagccgctgcgcggcggcacg
caccccggggcgttcggctcgtacccgcccgaggacgtcggatggctgctcaaggacctc
tccggcgcgcgcctcgaggcgccggcccacgagcgcgaggccgcgatccagtccggccgg
gcgagctacgcggagtccctgccgcaggagtacgagccgagccccgagtaccaggccctc
ttccgcgaggcgctcgcggcgtccggcgcgcggatcgcgcaggcggtcgccgacgtcacc
gagcaggtcctcgccctgcgcgggcgggagccggtgctcgtctcgctcgcccgggccggg
acccccgtcggggtgctcatgcgccggtgggccgcgcacgcccacggcctcgacgtgccg
cactacacgatgagcatcgtgcgcggactcgggatcgacgcgaacgcgctccgctggctg
ctcacccgccaccggcccgagcagatcatgttcgtggacgggtggacgggcaagggcgcg
atcacgcgggagctcgccgcggctctcgaggacttcgccaactcggacggcgtgcgcctc
tcccccgagctcgccgtcctggccgaccccgggcagtgcgtgcgcgtgtccggcacgcgc
gacgacttcctcatcccctccgcgtgcctgaactcgacggtctcggggctcgtctcccgc
acggtgttcaaccgcgcgctgatcggcccgcacgagacgcacggggccaagttctaccgc
gagctcgcgccgcgggacgtctcgaacgagttcgtcgatgcggtggcggcgcgcttcccc
gacatccgcccggggctgcccgggcccctcacggcgccgacgtgggcggggtgggccgcc
gtggagcgcatcgccgccgagcagggcctcgggcccctccgcagcgccgtgaacctcgtc
aagcccggcgtcggggaaaccacccgcgtgctgctgcgccgcgtgccctggaaggtgctc
gcccgcccggagctgctcgccacggacgacgccggccgcctcctgtgcggggacctcgcc
cacgtgctgctgctcgccgcccagcgggggtgccggtggagccggcagaggggctgccgt
acagctgcgtggggctcatccacccgcgcttcacgcccggcgcgacgggcgccgacggga
aggcggtggccgatgtctaggacggtggtggcgtgcgacctcgaccgcaccctcatctac
tccgcccgcgccctccacctcgagggccctgaccgggacgcgccccggctcgtggtgagc
gaggtctacgagaacgccccactgagctacatgacccgggcggccgaggacctcctgcac
gagctgctcggccgcgccgtcctcgtccccgtgaccaccaggacccaggcccagttcgcc
cgcgtccagctgccggcgaccccctacgcgatcaccaccaacggcggggtcctcctgcac
ggcgggacgcccgacggcgcgtggtccgcccgggtgcgcggcgccgtcgcccgcgggtcc
gcaccgatcggcgaggttctggcacgggtgtgcgagaacgctccgccctgggtggaccgg
gtccggaccgccgaggacctgttcgcctacgcgatcgtggaccgggccgcgctgccggcg
ggatggctggcggacctctccggctggtgcgccgggcgcggctgggtcgtctcgctccag
ggccgcaagctctactgcgtcccctcggccgtgaccaaggagtccgccgtcgccgaggtc
atggagcgcgtcggggcgagcgggctcgtcgcggccggagactcgctcctggaccggggc
ctgctcgagctggccgacctcccgctgcgcccccggcacggcgagctcgaggacgccgga
tacacccggccggggctgcgggtgacggagagcgccggggtcctggcaggcgaggagatt
ctccgggcggcgctggaggcggccacggtcccctcgggccctcaggcggcgggggccgag
gcgtccttggcccactcctcggccatgaggcggtag

DBGET integrated database retrieval system