KEGG   Spiroplasma atrichopogonis: SATRI_v1c10010Help
Entry
SATRI_v1c10010    CDS       T03973                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
satr  Spiroplasma atrichopogonis
Pathway
satr00430  Taurine and hypotaurine metabolism
satr00620  Pyruvate metabolism
satr00640  Propanoate metabolism
satr00680  Methane metabolism
satr01100  Metabolic pathways
satr01120  Microbial metabolism in diverse environments
satr01200  Carbon metabolism
Module
satr_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:satr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SATRI_v1c10010 (ackA)
   00640 Propanoate metabolism
    SATRI_v1c10010 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    SATRI_v1c10010 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SATRI_v1c10010 (ackA)
Enzymes [BR:satr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SATRI_v1c10010 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKM53371
Position
complement(900602..901792)
Genome map
AA seq 396 aa AA seqDB search
MILVINAGSSSMKFQLYKVNGENNYEVICKGLAERIYLDGVFKIKFNGQEFETKEDLKDH
EATAKVLINKLEEHGIIKDFSDITGIGHRIVHGGEKFTQSTVITDEVFAEIKKMVILAPL
HNPPAISAIEAFQKITSVPNVAVFDTSFHATMPVENYLYSGPYKWYTDHQVRRYGFHGIS
YRYITKRLGTILNKPIDKVKAIVCHLGNGASICAVKNGQSYNTSMGITPLEGLIMGTRSG
DIDPSIPNYIASQTGEDIVAITNTLNKKSGLLGISGVSSDLRDVVGSAESNPRSKLALKM
SAKRIAKYIVAYLNELGGNADAIVFTAGIGENSAIMRSLVANEVKLINFDLVKEHNEQGY
DSENLISGANATVPVYAIRTNEEIIICEDTYHLTQK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatattagtgatcaatgctggaagtagttcaatgaaatttcaattatataaagtaaac
ggggagaataattacgaagttatttgtaaaggtttggccgaacgaatttatttagatggg
gtttttaaaattaaatttaatgggcaagagtttgaaaccaaagaagatttaaaagaccat
gaagcaacagcgaaagtattaattaataaattagaagaacacggaattattaaagatttt
tctgatatcaccggaattggacaccgaattgtgcatgggggtgaaaaatttacgcagtca
acggtcattacagatgaagtttttgcggaaattaaaaaaatggttattttagcaccatta
cataatcctcccgcaatttcggcgatcgaagccttccaaaaaattactagtgttccaaat
gtggcagtgtttgatacttcattccatgccacaatgccagttgaaaattatttatattct
gggccatataaatgatatactgaccaccaagttcgccgctatggattccacggaatatca
tatcgttacattacaaaaagactaggaacaattttaaataaaccaattgataaagtaaaa
gccattgtttgtcacttaggaaatggagcaagtatttgtgcagttaaaaatggtcaaagt
tataatacttcaatgggaattaccccattagaaggattaattatgggaacccgtagtggt
gatattgacccgtcaattccaaactatattgcgagtcaaactggcgaagatattgttgcc
attaccaatactttaaataaaaaatcaggattattagggatttctggtgtttcttctgat
ttacgcgatgttgtagggagtgcagagagcaatccccgtagtaaattagctttaaaaatg
agtgcaaaaagaattgctaaatatattgtggcatatttaaatgaattagggggtaatgcc
gatgcgattgtcttcacagctggaattggggaaaattcagctataatgcgaagcttagtt
gccaatgaagttaaattaattaactttgacttagttaaagaacacaatgaacaaggctat
gattcggaaaacttaatttctggtgcaaatgccacagttcccgtttatgcaatccgtacg
aacgaagaaattataatttgtgaagatacttaccacttaacacaaaaataa

DBGET integrated database retrieval system