KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0218
Entry
SA0218            CDS       T00051                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00620  Pyruvate metabolism
sau00640  Propanoate metabolism
sau00650  Butanoate metabolism
sau01100  Metabolic pathways
sau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA0218 (pflB)
   00640 Propanoate metabolism
    SA0218 (pflB)
   00650 Butanoate metabolism
    SA0218 (pflB)
Enzymes [BR:sau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SA0218 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 zf-C2HCIx2C
Other DBs
NCBI-ProteinID: BAB41440
NITE: SA0218
UniProt: Q7A7X6
Position
258866..261115
AA seq 749 aa
MLETNKNHATAWQGFKNGRWNRHVDVREFIQLNYTLYEGNDSFLAGPTEATSKLWEQVMQ
LSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTEKPFKRSMQPFGGIRMAK
AACEAYGYELDEETEKIFTDYRKTHNQGVFDAYSREMLNCRKAGVITGLPDAYGRGRIIG
DYRRVALYGVDFLMEEKMHDFNTMSTEMSEDVIRLREELSEQYRALKELKELGQKYGFDL
SRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDIYAERDLKAGVITESEVQEI
IDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGIDGRPLVTKNSFRFLHSLDNLG
PAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDDIMRESYGDDYGIACCVSAMTI
GKQMQFFGARANLAKTLLYAINGGKDEKSGAQVGPNFEGINSEVLEYDEVFKKFDQMMDW
LAGVYINSLNVIHYMHDKYSYERIEMALHDTEIVRTMATGIAGLSVAADSLSAIKYAQVK
PIRNEEGLVVDFEIEGDFPKYGNNDDRVDDIAVDLVERFMTKLRSHKTYRDSEHTMSVLT
ITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRDQKGALSSLSSVAKIPYDCCKDGISN
TFSIVPKSLGKEPEDQNRNLTSMLDGYAMQCGHHLNINVFNRETLIDAMEHPEEYPQLTI
RVSGYAVNFIKLTREQQLDVISRTFHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgttagaaacaaataaaaatcatgcaacagcttggcaaggatttaaaaatggaagatgg
aacagacacgtagatgtaagagagtttatccaattaaactacactctttatgaaggtaat
gattcatttttagcaggaccaacagaagcaacttctaaactttgggaacaagtaatgcag
ttatcgaaagaagaacgtgaacgtggcggcatgtgggatatggacacgaaagtagcttca
acaatcacatctcatgatgctggttatttagacaaagatttagaaacaattgtaggtgta
caaactgaaaagccattcaaacgttcaatgcaaccattcggtggtattcgtatggcgaaa
gcagcttgtgaagcttacggttacgaattagacgaagaaactgaaaaaatctttacagat
tatcgtaaaacacataaccaaggtgtattcgatgcatattctagagaaatgttgaactgc
cgtaaagcaggtgtaatcactggtttacctgatgcatacggacgtggacgtattatcggt
gactatcgtcgtgtagctttatatggtgtagatttcttaatggaagaaaaaatgcacgac
ttcaacacgatgtctacagaaatgtcagaagatgtaattcgtttacgtgaagaattatca
gaacaatatcgtgcattaaaagaattaaaagaacttggacaaaaatatggtttcgattta
agccgtccagcagaaaacttcaaagaagcagttcaatggttatacttagcataccttgct
gcaattaaagaacaaaacggtgcagcaatgagtttaggtcgtacatcaacattcttagat
atctatgctgaacgtgaccttaaagcaggcgttattactgaaagcgaagttcaagaaatt
attgaccacttcatcatgaaattacgtattgttaaatttgctcgtacacctgattacaat
gaattattctctggagacccaacttgggtaactgaatctatcggtggtgtaggtattgac
ggacgtccacttgttacgaaaaactcattccgtttcttacactcattagataacttaggt
ccagctccagaaccaaacttaacagtattatggtcagtacgtttacctgacaacttcaaa
acatactgtgcaaaaatgagtattaaaacaagttctatccaatatgaaaatgatgacatt
atgcgcgaaagctatggcgatgactatggtatcgcatgttgtgtatcagcgatgacaatt
ggtaaacaaatgcaattcttcggtgcacgtgcgaacttagctaaaacattactttacgca
atcaatggtggtaaagatgaaaaatctggtgcacaagttggtccaaacttcgaaggtatt
aacagcgaagtattagaatatgacgaagtattcaagaaatttgatcaaatgatggattgg
ctagcaggtgtttacattaactcattaaatgttattcactacatgcacgataaatacagc
tatgaacgtattgaaatggcattacatgatacagaaattgtacgtacaatggcaacaggt
atcgctggtttatcagtagcagctgactcattatctgcaattaaatatgcacaagttaaa
ccaattcgtaacgaagaaggtcttgtagtagactttgaaatcgaaggcgacttccctaaa
tacggtaacaatgacgaccgtgtagatgatatcgcagttgatttagtagaacgcttcatg
actaaattacgtagtcataaaacatatcgtgattcagaacatacaatgagtgtattaaca
attacttcaaacgttgtatacggtaagaaaactggtaacacaccagacggacgtaaagct
ggcgaaccatttgctccaggtgcaaacccaatgcatggccgtgaccaaaaaggtgcatta
tcttcattaagttctgtagctaagatcccttacgattgctgtaaagatggtatttcaaat
acattcagtatcgtaccaaaatcattaggtaaagaaccagaagatcaaaaccgtaactta
actagtatgttagatggttacgcaatgcaatgtggtcaccacttaaatattaacgtattt
aaccgtgaaacattaatagatgcaatggaacatccagaagaatatccacagttaacaatc
cgtgtatctggttacgctgttaacttcattaaattaacacgtgaacaacaattagatgta
atttctcgtacattccatgaaagtatgtaa

DBGET integrated database retrieval system