KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0498
Entry
SA0498            CDS       T00051                                 

Gene name
rplL
Definition
(GenBank) 50S ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SA0498 (rplL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sau03011]
    SA0498 (rplL)
Ribosome [BR:sau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SA0498 (rplL)
  Bacteria
    SA0498 (rplL)
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-ProteinID: BAB41729
NITE: SA0498
UniProt: P99154
Position
578254..578622
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system