KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0947
Entry
SA0947            CDS       T00051                                 

Name
(GenBank) conserved hypothetical protein
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
SSDB
Motif
Pfam: UPF0223 Tk-SP_N-pro
Other DBs
NCBI-ProteinID: BAB42193
NITE: SA0947
UniProt: P67359
Position
1075896..1076171
AA seq 91 aa
MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIF
NTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaatatgagtatccaattgatttagactggagtaatgaagagatgatttcagtgata
aatttctttaatcatgtagagaagtattatgaatccggcgtgacggcaggcgactttatg
ggtgcatataaaagatttaaagaaattgtgcctgctaaagcagaggaaaaacaaattttt
aatactttcgaaaaaagtagtggctataatagttacaaagcagttcaagatgtaaaaact
cactctgaagaacaaagagtaacagctaaaaaataa

DBGET integrated database retrieval system