KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1714
Entry
SA1714            CDS       T00051                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00561  Glycerolipid metabolism
sau00564  Glycerophospholipid metabolism
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SA1714
   00564 Glycerophospholipid metabolism
    SA1714
Enzymes [BR:sau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     SA1714
SSDB
Motif
Pfam: DAGK_cat YegS_C NAD_kinase
Other DBs
NCBI-ProteinID: BAB42984
NITE: SA1714
UniProt: Q7A4Q8
Structure
PDB: 
2QV7 2QVL

Position
complement(1960373..1961320)
AA seq 315 aa
MRKRARIIYNPTSGKELFKRELPDALIKLEKAGYETSAYATEKIGDATLEAERAMHENYD
VLIAAGGDGTLNEVVNGIAEKPNRPKLGVIPMGTVNDFGRALHIPNDIMGALDVIIEGHS
TKVDIGKMNNRYFINLAAGGQLTQVSYETPSKLKSIVGPFAYYIKGFEMLPQMKAVDLRI
EYDGNVFQGEALLFFLGLTNSMAGFEKLVPDAKLDDGYFTLIIVEKSNLAELGHIMTLAS
RGEHTKHPKVIYEKAKAINISSFTDLQLNVDGEYGGKLPANFLNLERHIDVFAPNDIVNE
ELINNDHVDDNLIEE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggaaacgtgctagaatcatttataacccgacatcaggtaaagagctatttaaaaga
gaattacctgatgccttaataaaattagaaaaagcgggatatgaaacgagtgcatatgca
accgagaaaataggtgatgccacacttgaagcagaaagagctatgcatgaaaattatgat
gtattaatcgctgcaggtggtgatggaacattaaatgaagtagttaatggtatcgcagaa
aagcctaatcgtcctaagctaggtgtcattcctatgggtactgttaatgactttggacgt
gcattgcatatacctaatgacatcatgggggcacttgatgtcatcattgaaggtcattct
actaaagtagatattggtaaaatgaataatcgatactttattaatttagctgcaggcgga
caattgacgcaagtctcttatgaaacaccgagtaaattgaaatctattgttggtccattt
gcttattacatcaaaggtttcgaaatgttacctcaaatgaaagctgtagatttaagaatt
gaatatgatggtaatgttttccaaggagaagcattattattctttttaggtttaacaaat
tcaatggcaggatttgaaaaattagtgccggacgctaagttagatgacggctattttacg
ttaattatagttgaaaaatcaaaccttgcagaacttggtcatattatgactttagcttca
agaggagaacatactaagcatcctaaagttatttatgaaaaagcaaaggcaattaatatt
tcatcattcacagacttacaactaaatgtagatggagaatatggtggtaaattaccagcg
aatttcttaaatctagaacgtcatatagatgtctttgcacctaatgatattgtaaatgaa
gagttaataaataatgatcatgttgatgacaatttaatcgaagaataa

DBGET integrated database retrieval system