KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2108
Entry
SA2108            CDS       T00051                                 

Name
(GenBank) ORFID:SA2108; hypothetical protein, similar to transcription regulator, RpiR family
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 HTH_Crp_2 FleQ Med25
Other DBs
NCBI-ProteinID: BAB43407
NITE: SA2108
UniProt: A0A0H3JNM4
Position
2370486..2371358
AA seq 290 aa
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtcaaacgtactaacagaaatagatagtcaatatccatatatgactaaaaatgaaaaa
aagatagctaaatttatactaaattcacctcaaaaggtgattaaaatgaggtctcaagac
ttagcaagcttattagatattagtacatcatcagtcattcgattcagcaagaaaattact
gatggcggttttcacgacttgaaaataaatatatctaaatatgttcctaaagcatcatca
atttacaatgttgaattaatgaataacgaaagcacagaatctttaagaactaaactccat
acacgtactacacgcgcacttaatcatgcaaataacgaattaaatgataaaactattgat
caaatatgtcattgtttaaaacgttctgagacgatttttatatatggttttggcgcatct
tttgtagttgctaccgacttataccaaaagttatcaagaataggtcttaatattcaactt
gttcaagaaacacatatttttgctacattattagcaactcacaattcgaacgacagtgtt
attcttattactaacaatggtacgcaaagtgaaatgcaatcaatggttaaagttattgat
gactaccatatacctataattacaattactagtacaagggataatcccgtagcacaggca
tcaaatattgttttaacttatgggaaaactgatgaaaatgagatgcatatgggagcaaca
acttcattatttgctcaaatgttcactattgatattttatattatcgttatgttgcatta
aattatcacgcatcattagatttcataacacaatctaaaatggctttagataactatcgt
aaacatttatcaaatattaactttaaacattaa

DBGET integrated database retrieval system