KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2484
Entry
SA2484            CDS       T00051                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K10947  PadR family transcriptional regulator, regulatory protein PadR
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sau03000]
    SA2484
Transcription factors [BR:sau03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SA2484
Motif
Pfam: PadR HTH_34 TrmB DUF6429 FUR LexA_DNA_bind
Other DBs
NCBI-ProteinID: BAB43790
NITE: SA2484
UniProt: A0A0H3JWG6
Position
complement(2795305..2795643)
AA seq 112 aa
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtcagtgtcagatcagattatgaaaggtctcttagatggggcgatattaggtctcatt
gcccaaggcgaaacgtatggatatgaaattatgacgaaacttaagaatcaagagtttcca
gagataagtgagggtagtatttatccagttttaatgcgtttaaacaaaaaaggatacgtt
gatacgacaataaaaaaatctagtaatggcggcccgaggcggaaatactatacgattacc
gattcaggtttaaaggaactaaaagtatttaaatcaaaatggcaagctttgaataaaggg
atgattaacttgtttggaggggaaaacgatgttaactaa

DBGET integrated database retrieval system