KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0113Help
Entry
SA0113            CDS       T00051                                 

Gene name
sbnB
Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00998  Biosynthesis of secondary metabolites - other antibiotics
sau00999  Biosynthesis of secondary metabolites - unclassified
sau01100  Metabolic pathways
Module
sau_M00875  Staphyloferrin B biosynthesis, L-serine => staphyloferrin B
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SA0113 (sbnB)
   00999 Biosynthesis of secondary metabolites - unclassified
    SA0113 (sbnB)
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     SA0113 (sbnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP Ig_3 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: BAB41332
NITE: SA0113
UniProt: A0A0H3JN72
Structure
PDB: 

Position
129749..130759
Genome map
AA seq 336 aa AA seqDB search
MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIKRVFVYDQFSEACAR
FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagagatgttgtatttaaatagatcagatattgaacaagcgggaggtaatcat
tcacaagtttatgtggacgcattaacagaagcattaacagcccatgcgcacaatgatttt
gtacaaccgcttaagccgtatttaagacaggatcctgaaaatggacacatcgcagatcga
attattgcaatgccaagtcatatcggtggtgaacacgcaatttcaggtattaagtggata
ggtagtaagcacgacaatccatcgaaacgtaatatggagcgtgcaagtggtgtcattatt
ttgaatgatccagaaacgaattatccaattgcagttatggaagcaagtttaattagtagt
atgcgtactgcagcagtttcagtgattgcagctaagcatttggctaaaaaaggatttaaa
gacttaacaatcattggttgcgggctaatcggagacaagcaattacaaagtatgttagag
caattcgatcatattaaacgcgtgtttgtttacgatcaattctctgaagcatgtgcacgc
tttgttgatagatggcaacaacagcgtccggaaattaattttattgcgacagaaaatgct
aaagaagcagtatcaaatggtgaagtagtcattacatgtaccgtaacggatcaaccatac
attgaatatgattggttacaaaagggtgcatttattagcaacatttctatcatggatgtg
cataaagaagtctttattaaagctgacaaagtcgtagtagatgactggtcacaatgtaat
cgagaaaagaaaactattaaccaattggtgttagaaggtaaattcagcaaagaagcactt
catgctgaactagggcaacttgtgacaggtgacataccaggacgtgaagacgatgatgaa
atcatattacttaatccgatgggtatggctatcgaagatatttcaagtgcttattttatt
tatcaacaggcacaacaacaaaatattgggacaacattgaacctatattaa

DBGET integrated database retrieval system