KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0171Help
Entry
SA0171            CDS       T00051                                 

Gene name
fdh
Definition
(GenBank) NAD-dependent formate dehydrogenase
  KO
K00122  formate dehydrogenase [EC:1.17.1.9]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00630  Glyoxylate and dicarboxylate metabolism
sau00680  Methane metabolism
sau01100  Metabolic pathways
sau01120  Microbial metabolism in diverse environments
sau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SA0171 (fdh)
  09102 Energy metabolism
   00680 Methane metabolism
    SA0171 (fdh)
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     SA0171 (fdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh Gp_dh_N NAD_binding_2 IlvN
Motif
Other DBs
NCBI-ProteinID: BAB41392
NITE: SA0171
UniProt: A0A0H3JKG2
Position
193987..195111
Genome map
AA seq 374 aa AA seqDB search
MSNGAVFFVIFLKQATCNTYFKEVKIYHLGEMDMKIVALFPEAVEGQENQLLNTKKAIGL
KTFLEERGHEFIILADNGEDLDKHLPDMDVIISAPFYPAYMTRERIEKAPNLKLAITAGV
GSDHVDLAAASEHNIGVVEVTGSNTVSVAEHAVMDLLILLRNYEEGHRQSVEGEWNLSQV
GNHAHELQHKTIGIFGFGRIGQLVAERLAPFNVTLQHYDPINQQDHKLSKFVSFDELVSS
SDAITIHAPLTPETDNLFDKDVLSRMKKHSYLVNTARGKIVNRDALVEALASEHLQGYAG
DVWYPQPAPADHPWRTMPRNAMTVHYSGMTLEAQKRIEDGVKDILERFFNHEPFQDKDII
VASGRIASKSYTAK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacggtgccgttttttttgtcatatttttaaaacaagcaacatgcaacacgtac
tttaaggaagtcaaaatttatcatttaggagagatggatatgaaaatcgtagcattattt
ccagaagcagtagaaggtcaagaaaatcaattacttaatactaaaaaagcaataggatta
aaaacatttttagaggaaagaggacatgagttcattatattagcagataatggtgaagac
ttagataaacatttaccagatatggatgtgattattagtgcgccattttatcctgcatat
atgactcgtgaacgtattgaaaaagcaccgaacttgaaattagcaattacagcaggtgta
ggatctgaccatgtagatttagcggcagcaagtgaacacaatattggtgtcgttgaagtt
acaggaagtaatacagttagtgtggcagaacatgcggttatggatttattaatacttctt
agaaactatgaagaaggtcatcgtcaatcagtagaaggtgaatggaacttgtctcaagta
ggtaatcatgcgcatgaattacaacacaaaacaattggtatttttggatttggtcgaatt
ggacaacttgttgctgaaagattagcgccatttaatgtaacattacaacactatgatcca
atcaatcaacaagaccataaattgtctaaatttgtaagctttgatgaacttgtttcatca
agtgatgcgattacaattcatgcaccattaacaccagaaactgataacttatttgataaa
gatgttttaagtcgtatgaaaaaacacagttatttagtgaatactgcacgtggtaaaatt
gtaaatcgcgatgcgttagttgaagcgttagcatccgagcatttacaaggatatgctggt
gatgtttggtatccacaacctgcacctgctgatcatccatggagaacaatgcctagaaat
gctatgacggttcactattcaggtatgactttagaagcacaaaaacgcattgaagatgga
gttaaagatattttagagcgtttcttcaatcatgaacctttccaagataaagatattatt
gttgcaagtggtcgtattgctagtaaaagttatacagctaaatag

DBGET integrated database retrieval system