KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0528Help
Entry
SA0528            CDS       T00051                                 

Definition
(GenBank) ORFID:SA0528; hypothetical protein, similar to hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00030  Pentose phosphate pathway
sau00680  Methane metabolism
sau01100  Metabolic pathways
sau01120  Microbial metabolism in diverse environments
sau01200  Carbon metabolism
sau01230  Biosynthesis of amino acids
Module
sau_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
sau_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SA0528
  09102 Energy metabolism
   00680 Methane metabolism
    SA0528
Enzymes [BR:sau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     SA0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim TMP-TENI His_biosynth PRAI PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: BAB41759
NITE: SA0528
UniProt: Q7A774
Position
622952..623584
Genome map
AA seq 210 aa AA seqDB search
MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVKHMADNISNVKVLADM
KIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNKQLLVDMIAVQDLEKRA
KELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVAVAGGIKPDTIKDIVAES
PDLVIVGGGIANADDPVEAAKQCRAAIEGK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggaattacaattagcaattgatttattaaacaaagaagacgcggctgagttagcaaat
aaagtaaaagattatgtagatatcgtagaaatcggtacgccaatcatttacaacgaaggt
ttaccagcagttaaacatatggcagacaacattagtaatgtaaaagtattagcagacatg
aaaattatggatgcagctgattatgaagttagccaagcaattaaatttggcgcggatgta
attacaatactaggtgttgcagaagatgcatcaattaaagcagctattgaagaagctcat
aaaaataataaacaattactagttgatatgattgctgttcaagatttagaaaaacgtgca
aaagaactagatgaaatgggtgctgattatattgcagtacacactggttatgatttacaa
gcagaagggcaatcaccattagaaagtttaagaaccgttaaatctgttattaaaaattct
aaagttgcagtagcaggtggaattaaaccagatacaattaaagatattgtcgctgaaagt
cctgatcttgttattgttggtggcggaatcgcaaatgcagatgatccagtagaagctgca
aaacaatgtcgcgctgcaatcgaaggtaagtaa

DBGET integrated database retrieval system