KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0529Help
Entry
SA0529            CDS       T00051                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K08094  6-phospho-3-hexuloisomerase [EC:5.3.1.27]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00030  Pentose phosphate pathway
sau00680  Methane metabolism
sau01100  Metabolic pathways
sau01120  Microbial metabolism in diverse environments
sau01200  Carbon metabolism
sau01230  Biosynthesis of amino acids
Module
sau_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
sau_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SA0529
  09102 Energy metabolism
   00680 Methane metabolism
    SA0529
Enzymes [BR:sau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.27  6-phospho-3-hexuloisomerase
     SA0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS SIS_2 Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: BAB41760
NITE: SA0529
UniProt: A0A0H3JJZ7
Position
623586..624134
Genome map
AA seq 182 aa AA seqDB search
MAKFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKGRSGFVANSFAMRLNQ
LGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSVGADIVLITTNKDSAIG
NLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGLMTEMNVTEQTMQQNHAN
LE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatttagtgactatcaattaattctagatgaattaaagatgactttgtcacat
gttgaagcggatgagttttcaacttttgcatccaaaatactacatgctgaacatatattt
gtagctggcaaaggacgttcaggattcgtggcgaatagttttgcaatgcgcttaaatcag
ctcggcaaacaggcacatgttgttggagaatcaacgacacctgcgattaagtcgaatgat
gtatttgtaattatctctggttcaggttccacggaacatttaagattattagcagacaaa
gcaaaatcagtaggtgctgacatcgtattaattactacaaataaagattctgcaataggc
aatctagctgggacgaacatcgttttgcctgcaggtacaaaatatgatgaacaaggctcg
gcacaaccattaggaagtttgtttgaacaagcatctcaattatttttagatagtgttgta
atgggattgatgactgaaatgaatgttacggaacaaacgatgcaacaaaatcatgctaat
ttagaataa

DBGET integrated database retrieval system