KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0534Help
Entry
SA0534            CDS       T00051                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00071  Fatty acid degradation
sau00072  Synthesis and degradation of ketone bodies
sau00280  Valine, leucine and isoleucine degradation
sau00310  Lysine degradation
sau00362  Benzoate degradation
sau00380  Tryptophan metabolism
sau00620  Pyruvate metabolism
sau00630  Glyoxylate and dicarboxylate metabolism
sau00640  Propanoate metabolism
sau00650  Butanoate metabolism
sau00900  Terpenoid backbone biosynthesis
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
sau01212  Fatty acid metabolism
sau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA0534 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    SA0534 (vraB)
   00640 Propanoate metabolism
    SA0534 (vraB)
   00650 Butanoate metabolism
    SA0534 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SA0534 (vraB)
   00072 Synthesis and degradation of ketone bodies
    SA0534 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA0534 (vraB)
   00310 Lysine degradation
    SA0534 (vraB)
   00380 Tryptophan metabolism
    SA0534 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA0534 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SA0534 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA0534 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sau04147]
    SA0534 (vraB)
Enzymes [BR:sau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SA0534 (vraB)
Exosome [BR:sau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA0534 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAB41765
NITE: SA0534
UniProt: Q7A768
Position
628718..629857
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system