KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0791Help
Entry
SA0791            CDS       T00051                                 

Definition
(GenBank) ORFID:SA0791; hypothetical protein, similar to glycerate dehydrogenase
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored AdoHcyase_NAD IlvN
Motif
Other DBs
NCBI-ProteinID: BAB42030
NITE: SA0791
UniProt: A0A0H3JTJ9
Position
896909..897868
Genome map
AA seq 319 aa AA seqDB search
MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
CINNIEAVMTNQVPHTPVN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttggtaaaaatagttgtttcgaggaaaattccagataaattttatcaacaattaagtaaa
cttggtgacgttgttatgtggcaaaaatcattagtgcctatgcctaaagatcaatttgtg
acagcacttcgtgacgcagatgcttgttttattacattaagtgaacagatcgatgcagaa
attttagcacaatcaccaaatttaaaagtaattgcgaatatggctgtaggatatgacaac
atcgatgttgaaagtgcaacagcgaataacgtggttgtcacgaatacaccaaatgtactt
actgaaacaactgcagaattaggatttacattaatgcttgctatagcacgccgtattgta
gaagctgaaaaatatgtagaagcagatgcatggcaaagctggggtccttatttattgtca
ggtaaagatgtcttcaattcaactattggaatatatggtatgggagatattggtaaagct
tttgcaagaaggttgcaagggtttaatactaatattctttatcataatcgatcaagacat
aaagatgcagaggcggactttaatgcaacatatgtttcttttgaaacgttgttagcagaa
agtgattttatcatctgtacagcgccacttacaaaagaaacacatcataaatttaatgct
gaagcatttgaacaaatgaaaaatgatgcaatttttattaatatcggtagagggcaaatt
gtagatgaaacagcattaatcgatgcactagacaataaagaaattttagcatgtggttta
gatgtattagcaaatgaaccgattgatcatacacatccattaatgggacgtgataatgtt
ctgattacaccacacattggtagcgcatcagtaacaacacgggacaatatgattcaatta
tgtattaataatatagaagcggttatgacaaatcaggtaccacatactccagtaaattga

DBGET integrated database retrieval system