KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0795Help
Entry
SA0795            CDS       T00051                                 

Gene name
dltC
Definition
(GenBank) D-alanyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00473  D-Alanine metabolism
sau01100  Metabolic pathways
sau01503  Cationic antimicrobial peptide (CAMP) resistance
sau02020  Two-component system
sau05150  Staphylococcus aureus infection
Module
sau_M00725  Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SA0795 (dltC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SA0795 (dltC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    SA0795 (dltC)
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SA0795 (dltC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sau01504]
    SA0795 (dltC)
Enzymes [BR:sau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     SA0795 (dltC)
Antimicrobial resistance genes [BR:sau01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SA0795 (dltC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: BAB42034
NITE: SA0795
UniProt: P0A019
Position
901134..901370
Genome map
AA seq 78 aa AA seqDB search
MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
RDEWATPNKIVEALEELR
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagagaacaagtattaaatttattagcagaagtagcagaaaatgatattgta
aaagaaaatccagacgtagaaatttttgaagaaggtattattgattctttccaaacagtt
ggattattattagagattcaaaataaacttgatatcgaagtatctattatggactttgat
agagatgagtgggcaacaccaaataaaatcgttgaagcattagaagagttacgatga

DBGET integrated database retrieval system