KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1129Help
Entry
SA1129            CDS       T00051                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18682  ribonucrease Y [EC:3.1.-.-]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sau00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SA1129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sau03019]
    SA1129
Enzymes [BR:sau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SA1129
Messenger RNA biogenesis [BR:sau03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     SA1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3552 HD HDOD KH_1 KH_4 KH_2
Motif
Other DBs
NCBI-ProteinID: BAB42381
NITE: SA1129
UniProt: P67278
Position
1281967..1283526
Genome map
AA seq 519 aa AA seqDB search
MNLLSLLLILLGIILGVVGGYVVARNLLLQKQSQARQTAEDIVNQAHKEADNIKKEKLLE
AKEENQILREQTEAELRERRSELQRQETRLLQKEENLERKSDLLDKKDEILEQKESKIEE
KQQQVDAKESSVQTLIMKHEQELERISGLTQEEAINEQLQRVEEELSQDIAVLVKEKEKE
AKEKVDKTAKELLATAVQRLAADHTSESTVSVVNLPNDEMKGRIIGREGRNIRTLETLTG
IDLIIDDTPEAVILSGFDPIRREIARTALVNLVSDGRIHPGRIEDMVEKARKEVDDIIRE
AGEQATFEVNAHNMHPDLVKIVGRLNYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLA
KRAGLLHDVGKAIDHEVEGSHVEIGVELAKKYGENETVINAIHSHHGDVEPTSIISILVA
AADALSAARPGARKETLENYIRRLERLETLSESYDGVEKAFAIQAGREIRVIVSPEEIDD
LKSYRLARDIKNQIEDELQYPGHIKVTVVRETRAVEYAK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttattaagcctcctactcattttgctggggatcattctaggagttgttggaggg
tatgttgttgcccgaaatttgttgcttcaaaagcaatcacaagctagacaaactgccgaa
gatattgtaaatcaagcacataaagaagctgacaatatcaaaaaagagaaattacttgag
gcaaaagaagaaaaccaaatcctaagagaacaaactgaagcagaactacgagaaagacgt
agcgaacttcaaagacaagaaacccgacttcttcaaaaagaagaaaacttagagcgcaaa
tctgatctattagataaaaaagatgagattttagagcaaaaagaatcaaaaattgaagaa
aaacaacaacaagtagatgcaaaagagagtagtgttcaaacgttaataatgaagcatgaa
caagaattagaacgcatctccggtctcactcaagaagaagctattaatgagcaacttcaa
agagtagaggaagaactgtcacaagatattgcagtacttgttaaagaaaaagaaaaagaa
gctaaagaaaaagttgataaaacagcaaaagaattattagctacagcagtacaaagatta
gcagcagatcacacaagtgaatcaacggtatcagtagttaacttacctaatgatgagatg
aaaggtcgaatcattggacgagaaggacgaaacatccgcacacttgaaactttaactggc
attgatttaattattgatgacacaccagaagcggttatattatctggttttgatccaata
agaagagaaattgctagaacagcacttgttaacttagtatctgatggacgtattcatcca
ggtagaattgaagatatggtcgaaaaagctagaaaagaagtagacgatattattagagaa
gcaggtgaacaagctacatttgaagtgaacgcacataatatgcatcctgacttagtaaaa
attgtagggcgtttaaactatcgtacgagttacggtcaaaatgtacttaaacattcaatt
gaagttgcgcatcttgctagtatgttagctgctgagctaggcgaagatgagacattagcg
aaacgagctggacttttacatgatgttggtaaagcaattgatcatgaagtagaaggtagt
catgttgaaatcggtgtagaattagcgaaaaaatatggtgaaaatgaaacagttattaat
gcaatccattctcaccatggtgatgttgaacctacatctattatatctatccttgttgct
gctgcagatgcattgtctgcggctcgtccaggtgcaagaaaagaaacattagagaattat
attcgtcgattagaacgtttagaaacgttatcagaaagttatgatggtgtagaaaaagca
tttgcgattcaggcaggtagagaaatccgagtgattgtatctcctgaagaaattgatgat
ttaaaatcttatcgattggctagagatattaaaaatcagattgaagatgaattacaatat
cctggtcatatcaaggtgacagttgttcgagagactagagcagtagaatatgcgaaataa

DBGET integrated database retrieval system