KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1204Help
Entry
SA1204            CDS       T00051                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00260  Glycine, serine and threonine metabolism
sau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01130  Biosynthesis of antibiotics
sau01230  Biosynthesis of amino acids
Module
sau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SA1204 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SA1204 (trpB)
Enzymes [BR:sau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SA1204 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAB42464
NITE: SA1204
UniProt: P66987
Position
1376947..1378161
Genome map
AA seq 404 aa AA seqDB search
MNKQIQTEADELGFFGEYGGQYVPETLMPAIIELKKAYKEAKADPEFQRELEYYLSEYVG
RATPLTYAASYTESLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKKKLVAETGAG
QHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVEEGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKEGRLPDAIVACIGG
GSNAIGTFYPFIKDDVALYGVEAAGQGEDTDKHALAIGKGSPGVLHGTKMYLIQDEGGQV
QLAHSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHA
LSYVERLAPTMSKEDIIVVTISGRGDKDMETIRQYMAERGLAND
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaaatacaaacagaagcagatgaattaggtttctttggtgaatatggaggg
caatatgttccagaaacattaatgccagcaattattgagttgaaaaaagcttataaagag
gcaaaagcagacccagagtttcaaagagaactggaatactatttatcagagtatgtagga
cgcgcgacaccacttacatatgctgcatcatatactgaaagcctaggtggcgctaaaata
tatttgaaacgagaggatctaaatcatacaggcgcccataaaattaataatgcgttaggt
caagcgttgcttgctaaaagaatgggcaagaagaagcttgttgctgaaactggtgcgggt
caacatggtgtagctagtgctacggttgctgcattatttgatatggaacttgttgtcttt
atgggaagtgaagatattaaaagacaacaacttaatgtatttagaatggaattacttggt
gcaaaggttgtggcagttgaagaaggtcaagggactttatcggatgcagttaataaagca
ttgcaatattgggtaagtcatgtagatgatacacattatttattaggttctgcattaggt
ccagacccattcccaacgattgttagagattttcagagtgtcattggtaaagaaataaaa
tcacagatattgaagaaagaaggtcgacttccggatgcaattgtagcatgtatcggtggt
ggctcaaatgcaatcggtacattttatccatttattaaagatgatgttgcattatacggt
gttgaagccgcaggtcaaggcgaggatactgataaacatgcacttgcaattggcaaagga
tcacctggcgtattacatggtactaaaatgtatttaattcaagatgaaggtgggcaagtg
caactagcacattctatttcagcaggacttgattatcctggtattgggcctgaacattct
tattaccacgacattggtagagtaacttttgaaaatgcaagtgatacacaagcaatgaat
gctttaatcaactttacaaaacatgaaggtattatacctgcaattgaaagtgcacatgca
ctgagttatgttgaaagactagcgcctacgatgtcgaaagaagatattattgtagtaact
atttctggacgtggcgataaagatatggaaacaattagacaatatatggcagagcgaggt
cttgcaaatgactaa

DBGET integrated database retrieval system