KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1299Help
Entry
SA1299            CDS       T00051                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01130  Biosynthesis of antibiotics
sau01230  Biosynthesis of amino acids
Module
sau_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SA1299 (aroC)
Enzymes [BR:sau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     SA1299 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: BAB42559
NITE: SA1299
UniProt: P63614
Position
complement(1505516..1506682)
Genome map
AA seq 388 aa AA seqDB search
MRYLTSGESHGPQLTVIVEGIPANLEIKVEDINKEMFKRQGGYGRGRRMQIEKDTVEIVS
GVRNGYTLGSPITMVVTNDDFTHWRKIMGAAPISEEERENMKRTITKPRPGHADLVGGMK
YNHRDLRNVLERSSARETAARVAVGALCKVLLQQLDIDIYSRVVEIGGIKDKDFYDSETF
KANLDRNDVRVIDDSIAQAMRDKIDEAKNEGDSIGGVVQVVVENMPVGVGSYVHYDRKLD
GKIAQGVVSINAFKGVSFGEGFKAAEKPGSEIQDEILYNSEIGYYRGSNHLGGLEGGMSN
GMPIIVNGVMKPIPTLYKPLNSVDINTKEDFKATIERSDSCAVPAASIVCEHVVAFEIAK
ALLEEFQSNHIEQLQQQIADRRQLNVEF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagatatctaacttcaggagaatcacatggacctcaattaacagttattgtcgaaggt
ataccagcaaatttagaaattaaagttgaagatattaataaagaaatgttcaagcgtcaa
gggggttatggtcgtggccgacgcatgcaaattgagaaagatacagtagaaatagtatca
ggcgttagaaatggttatacattaggtagtccaattactatggttgtaaccaatgatgac
tttacgcattggagaaaaattatgggagcagctccaataagtgaagaagaacgtgaaaat
atgaaacgtactattacaaaaccaagacctggtcatgcagatttggttggaggtatgaaa
tataatcatcgtgatttacgaaatgtgctagagcgatcatctgctagagaaacagcagct
cgagttgcagtcggtgccttatgtaaagtgttattacaacagttagatatcgatatatac
agtcgtgttgttgaaataggtggcattaaagataaagatttttatgattcagaaacattt
aaagcaaatcttgatcgtaatgatgttcgtgtaattgatgacagtatcgcacaagcaatg
cgagataaaattgacgaagctaaaaatgaaggagattcaattggcggtgtcgttcaagtt
gtagttgaaaatatgcctgttggtgttggtagttatgtgcattatgatcgtaagttagat
ggtaagattgcacaaggtgttgtcagcataaatgcttttaaaggtgtaagctttggagaa
ggatttaaagcagctgaaaagccaggtagtgagattcaagatgaaattctatataatagt
gaaattggttattatcgtggatctaatcatttaggtggtttagagggtggtatgtcaaat
ggtatgccaattattgtaaatggtgtaatgaaacctattcctacgttatataaaccatta
aattcagttgatataaatactaaagaagactttaaggcaacaattgaacgttctgatagt
tgtgctgtacctgcagcaagtatagtgtgtgaacacgttgttgcatttgaaatagcgaaa
gcattacttgaagagtttcaatcaaaccatattgaacaacttcaacaacaaattgctgac
cgcagacaattaaatgttgagttttaa

DBGET integrated database retrieval system