KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1336Help
Entry
SA1336            CDS       T00051                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00030  Pentose phosphate pathway
sau00480  Glutathione metabolism
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SA1336
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SA1336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sau04147]
    SA1336
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SA1336
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SA1336
Exosome [BR:sau04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SA1336
  Exosomal proteins of colorectal cancer cells
   SA1336
  Exosomal proteins of bladder cancer cells
   SA1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Caprin-1_dimer
Motif
Other DBs
NCBI-ProteinID: BAB42598
NITE: SA1336
UniProt: A0A0H3JMN5
Position
1542651..1544135
Genome map
AA seq 494 aa AA seqDB search
MSTKNKHIPCLITIFGATGDLSHRKLFPSIFHLYQQDNLDEHIAIIGIGRRDITNDDFRN
QVKSSIQKHVKDTNKIDAFMEHVFYHRHDVSNEESYQELLDFSNELDSQFELKGNRLFYL
AMAPQFFGVISDYLKSSGLTDTKGFKRLVIEKPFGSDLKSAEALNNQIRKSFKEEEIYRI
DHYLGKDMVQNIEVLRFANAMFEPLWNNKYISNIQVTSSEILGVEDRGGYYESSGALKDM
VQNHMLQMVALLAMEAPISLNSEDIRAEKVKVLKSLRHFQSEDVKKNFVRGQYGEGYIDG
KQVKAYRDEDRVADDSNTPTFVSGKLTIDNFRWAGVPFYIRTGKRMKSKTIQVVVEFKEV
PMNLYYETDKLLDSNLLVINIQPNEGVSLHLNAKKNTQGIETEPVQLSYSMSAQDKMNTV
DAYENLLFDCLKGDATNFTHWEELKSTWKFVDAIQDEWNMVDPEFPNYESGTNGPLESDL
LLARDGNHWWDDIQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgagtactaaaaacaaacacatcccttgtttaatcacaatctttggtgcaactggtgac
ttaagccatcgtaagttgtttccatcaatattccatctctaccaacaagacaatttagat
gaacatattgccatcatcggtattggacgtcgtgacattactaatgatgatttccgtaat
caagtaaaatcatcaattcaaaagcacgtaaaagatacaaacaaaattgacgcgtttatg
gaacatgtcttctatcatagacatgatgttagtaatgaagaaagctatcaagaattacta
gattttagtaatgaattagatagccaatttgaattaaaaggtaatcgactattctattta
gcaatggcaccacaattctttggcgttatttctgattatctaaaatcttctggtcttact
gatacaaaaggatttaaacgccttgttatcgaaaaaccattcggtagtgatttaaaatca
gccgaagcattaaacaatcaaattcgtaaatcatttaaagaagaagaaatttatcgtatt
gaccactatttaggaaaagacatggttcaaaatatcgaggtattacgttttgcgaatgcg
atgtttgaaccattatggaataacaaatatatttcaaacatccaagttacatcttctgaa
atactaggtgttgaagatcgtggtggttattatgaatcaagtggcgcgctaaaagatatg
gtgcaaaaccacatgttacaaatggttgcattattagctatggaagcacctattagttta
aacagtgaagatatccgtgctgagaaagtaaaagtacttaaatcactgcgtcatttccaa
tctgaagatgttaaaaagaactttgttcgtggtcaatatggcgaaggctatatcgatggt
aaacaagttaaagcataccgtgatgaagatcgcgttgcagatgactctaacacacctacc
tttgtttcaggtaaattaacaattgataactttagatgggctggtgtaccattctatatt
cgtactggtaaacgtatgaaatctaaaacaattcaagttgtcgttgaatttaaagaagta
ccaatgaacttatactatgaaactgataaactattagattcaaacctattagtaatcaat
atccaacctaatgaaggtgtatctttacatctaaatgctaagaaaaatacacaaggtatc
gaaactgaacctgttcaattgtcttattcaatgagcgctcaagataaaatgaatactgta
gatgcatatgaaaatctattattcgattgtcttaaaggtgatgccactaacttcacgcac
tgggaagaattaaaatcaacatggaaatttgttgatgcaattcaagatgaatggaatatg
gttgatccagaattccctaactatgaatcaggtactaatggtccattagaaagtgattta
ctacttgctcgtgatggtaaccattggtgggacgatattcaataa

DBGET integrated database retrieval system