KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1352Help
Entry
SA1352            CDS       T00051                                 

Gene name
ispA
Definition
(GenBank) ORFID:SA1352; geranyltranstransferase homolog
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00900  Terpenoid backbone biosynthesis
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01130  Biosynthesis of antibiotics
Module
sau_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA1352 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sau01006]
    SA1352 (ispA)
Enzymes [BR:sau01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SA1352 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SA1352 (ispA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     SA1352 (ispA)
Prenyltransferases [BR:sau01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SA1352 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: BAB42614
NITE: SA1352
UniProt: A0A0H3JL30
Structure
PDB: 

Position
complement(1562949..1563830)
Genome map
AA seq 293 aa AA seqDB search
MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
YELGVKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
LLTFAVMSAADIANVDDATKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatctaccgatgaataaattaatagatgaagtcaataatgaattatcggttgcg
ataaataaatcagtaatggatactcagctagaagaaagcatgttgtattcattaaatgct
ggaggtaaacgcatccgaccagttctgttattactcactttagattcactaaataccgag
tatgagttaggtgtgaagagcgcaattgcactagaaatgattcatacatattcacttatt
catgatgacctaccagcgatggataatgatgattatcgacgagggaaattaacaaatcat
aaagtatatggtgagtggactgcgatattagcaggtgatgctttattaactaaagcattt
gaacttatttcaagtgatgatagattaactgatgaagtaaaaataaaagttctacaacgg
ctgtcaatagcaagtggtcatgttggaatggtcggcggtcaaatgttagatatgcaaagc
gaaggccaaccaattgatcttgaaactttggaaatgatacacaaaacaaaaacaggagca
ttattaacttttgcggttatgagtgcagcagatatcgctaatgtcgatgatgcaactaaa
gaacatttagaaagttatagttatcatttaggtatgatgttccagattaaagatgattta
ttagactgctatggtgatgaagcaaagttaggtaaaaaagtgggcagcgatcttgaaaat
aataaaagtacgtacgtgagtttattagggaaagatggcgcagaagataaattgacttat
catagagacgcagcagtggatgaactaacgcaaattgatgaacaattcaatacaaaacac
ttattagaaatcgttgatttattttatagcagggatcactaa

DBGET integrated database retrieval system