KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1599Help
Entry
SA1599            CDS       T00051                                 

Definition
(GenBank) ORFID:SA1599; hypothetical protein, similar to transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00030  Pentose phosphate pathway
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
sau01230  Biosynthesis of amino acids
Module
sau_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SA1599
Enzymes [BR:sau01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     SA1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: BAB42867
NITE: SA1599
UniProt: A0A0H3JLF7
Position
complement(1836897..1837610)
Genome map
AA seq 237 aa AA seqDB search
MAKLNVEVFADGADIEEMKAAYKNKQVDGFTTNPSLMAKAGVTDYKAFAEEAVKEIPDAS
ISFEVFADDLETMEKEAAILKQYGENVFVKIPIVNTKGESTIPLIKKLSADNVRLNVTAV
YTIEQVKEITEAVTEGVPTYVSVFAGRIADTGVDPLPLMKEAVKVTHSKDGVKLLWASCR
ELFNVIQADEIGADIITRPADVVKKVNTNLGRDINELSVDTVKGFAKDIQSSGLSIL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactaaatgtagaagtatttgcggacggtgcagatattgaagaaatgaaagca
gcttataaaaacaaacaagtggatggttttacaacaaatcctagtttaatggcgaaagcg
ggcgtaacagattacaaagcttttgctgaagaagctgtgaaagaaattccagatgcttca
atttcatttgaagtatttgcagacgatttagaaactatggaaaaagaagcagcaatttta
aaacaatatggcgaaaatgtatttgttaaaattcctattgtaaatacaaaaggtgaatca
acgattcctttaattaaaaaactttcagctgacaatgtgagattaaacgttacggctgtt
tacacaattgaacaagttaaagaaataactgaagcagtaactgaaggtgtgccaacatat
gtttcagtatttgcaggacgtattgcagatacaggcgtagatccattaccattaatgaaa
gaggctgtaaaagttacgcatagtaaagacggcgttaaattattatgggcaagttgccgc
gaattattcaatgtgattcaagctgatgaaattggtgcagatattattacacgccctgca
gatgttgtgaaaaaagtgaatacaaacttaggtcgcgatattaacgaattatcagtagat
acagttaaaggctttgcgaaagatattcaatcttcaggtctttctattctataa

DBGET integrated database retrieval system