KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1679Help
Entry
SA1679            CDS       T00051                                 

Definition
(GenBank) ORFID:SA1679; hypothetical protein, similar to D-3-phosphoglycerate dehydrogenase
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N Shikimate_DH AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAB42948
NITE: SA1679
UniProt: A0A0H3JLL6
Position
complement(1925167..1926117)
Genome map
AA seq 316 aa AA seqDB search
MKVVGLNRMREVETELQQRFSDLDFKFYKKASEIPESDLADLDILVGYDGGINEAFLQRC
PNLKWIAWFATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDN
QRQHIYDSKITGKRLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSKSGQNKDEFDEIY
TIESLESTLPNADIIINALPETQETIHLLKKKHFELMKDEALFINIGRGSIVKEALLIEV
LKSKVIRHAYLDVFENEPLKPNHELYELENVTITAHITGNDYEAKYDLLDIFKNNLVNFL
NKNGLIENEVDAKKGY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgttgggttaaatcgtatgcgtgaagttgaaactgaattacaacaacgcttt
tcagatttagattttaaattttataaaaaagcatcagaaatacctgagagtgacttggct
gatttagatatattagttggttatgatggcggtatcaatgaggcatttttacaacgttgc
ccgaatttaaaatggattgcatggtttgcaacgggtgtaaatacattaccgttagattat
attgcagatcacggcatacttttaactaatggaaaaggtgttcaagctaaacaattatct
gaatacattttagctttcattttagatgattataaaaagatgaaactatcatatgataac
caaagacaacatatatatgattcgaaaataactggtaaacgcctatcaggacaaacagtt
ttatttttaggtacaggtgcaattgctactagaactgcgaagttagcaaaggcttttaat
atgaatttaattggtctgagcaagtcaggtcagaacaaagatgagtttgacgagatatat
actatcgaatcacttgaaagcacattaccaaatgctgacattattataaatgctttacca
gaaacgcaagaaacgattcatttactaaagaaaaaacattttgaattaatgaaagatgaa
gcactttttataaatataggacgaggtagcatagttaaagaagcgctcttaatagaagta
ttaaaaagtaaagttattcgacatgcatatttagatgtgtttgaaaatgaacctttgaaa
cctaatcatgaattatatgaattggaaaatgtaactataacagcgcatataactggtaat
gattatgaggcaaagtatgacttattagatatttttaaaaacaatctagttaattttctc
aataagaatggtctaattgagaatgaagttgatgctaaaaaaggctattaa

DBGET integrated database retrieval system