KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1936Help
Entry
SA1936            CDS       T00051                                 

Gene name
luxS
Definition
(GenBank) autoinducer-2 production protein LuxS
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00270  Cysteine and methionine metabolism
sau01100  Metabolic pathways
sau01230  Biosynthesis of amino acids
sau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SA1936 (luxS)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SA1936 (luxS)
Enzymes [BR:sau01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     SA1936 (luxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxS
Motif
Other DBs
NCBI-ProteinID: BAB43220
NITE: SA1936
UniProt: P65330
Position
2186360..2186830
Genome map
AA seq 156 aa AA seqDB search
MTKMNVESFNLDHTKVVAPFIRLAGTMEGLNGDVIHKYDIRFKQPNKEHMDMPGLHSLEH
LMAENIRNHSDKVVDLSPMGCQTGFYVSFINHDNYDDVLNIVEATLNDVLNATEVPACNE
VQCGWAASHSLEGAKTIAQAFLDKRNEWHDVFGTGK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatgaatgttgaaagtttcaatttagatcatactaaagtggttgccccattt
attagattagcgggaacgatggaaggattaaacggagatgtcattcacaaatacgacatt
cgtttcaaacaaccaaacaaagaacatatggatatgccaggactacattcattagaacat
ttaatggctgaaaatattagaaatcatagtgacaaagttgttgatttaagtcctatgggt
tgccaaactggtttctatgtatcatttattaatcatgataattatgatgatgtattaaat
attgttgaagcaactttaaatgatgtgctaaatgctactgaagtgcctgcttgtaatgaa
gtacaatgtggctgggcagcaagtcattcattagaaggtgctaaaactatcgctcaagca
tttctagacaaacgaaacgaatggcatgatgttttcggtacaggaaaataa

DBGET integrated database retrieval system