KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2098Help
Entry
SA2098            CDS       T00051                                 

Definition
(GenBank) ORFID:SA2098; hypothetical protein, similar to glycerate dehydrogenase
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN F420_oxidored NAD_binding_2 HU-CCDC81_euk_1
Motif
Other DBs
NCBI-ProteinID: BAB43397
NITE: SA2098
UniProt: Q7A417
Position
2358178..2359131
Genome map
AA seq 317 aa AA seqDB search
MEKVYVAGAIPEVGLKLLQEHFEVEMYEGKGLVDKDTLIKGVKNATALISLLSTNVDKDV
IDAGKDLKIIANYGAGFNNIDIEYAREKSIDVTNTPKASTNATADLTIGLVLAVARRIVE
GDQLSRTTGFDGWAPLFFRGREVSGKTIGIIGLGEIGSAVARRARAFDMDVLYTGPNRKE
EKEREIGAKYVDLDTLLKNADFITINAAYNPKMHHLIDTEQFKMMKSTVYLINASRGPIV
HEQALVQALKDNEIEGAALDVYEFEPDITDDLKSLNNVVLTPHIGNATFEARDMMSKIVA
NAAISAVQGEKPQFVVN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtttatgttgctggtgcaataccagaagtagggttaaaacttttacaagaa
cattttgaagttgaaatgtatgaaggtaaaggattagtcgataaagacactttaattaaa
ggtgttaaaaacgcgactgccttaattagtttattatctacaaacgttgataaagatgtt
atcgatgctggtaaagacttaaaaatcattgccaactatggcgctggttttaataatatt
gatatcgagtatgcccgagaaaaaagtatagatgttacaaacacacctaaagcatcaaca
aacgcgactgctgatttaacaattggattagtacttgcagtagctcgtcgtattgttgaa
ggggaccaattatcacgtacaactggatttgacggatgggcacctttatttttcagaggt
agagaagtatctgggaaaacaatcggcattatcggtttaggtgaaattggtagtgcagta
gctcgtcgtgcaagagcatttgacatggatgtgctatacactggacctaatcgcaaagaa
gaaaaagaacgagaaatcggtgcaaaatatgtagatttagatacactattaaagaatgca
gattttatcactatcaacgctgcttataatcctaaaatgcatcatttaattgatacagaa
caatttaaaatgatgaaatctacggtgtatttaatcaatgcctctcgtggtccaatcgtg
cacgaacaagcactagtgcaagcattgaaagataatgaaattgaaggtgctgcacttgat
gtatatgaatttgaaccagatattaccgatgacttaaaatcacttaataatgtagtatta
acaccgcatattggtaatgctacatttgaagcacgtgacatgatgtctaaaattgttgct
aatgctgcaattagtgccgttcaaggtgagaaaccacaatttgtcgttaactaa

DBGET integrated database retrieval system