KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2127Help
Entry
SA2127            CDS       T00051                                 

Definition
(GenBank) ORFID:SA2127; hypothetical protein, similar to ribose 5-phosphate isomerase (rpi)
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00030  Pentose phosphate pathway
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
sau01230  Biosynthesis of amino acids
Module
sau_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
sau_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SA2127
Enzymes [BR:sau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SA2127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Flavoprotein
Motif
Other DBs
NCBI-ProteinID: BAB43428
NITE: SA2127
UniProt: P66695
Position
complement(2392553..2393239)
Genome map
AA seq 228 aa AA seqDB search
MKDVKALKLMTLNDVLSQINGDMTLGIGTGSTMELLLPQMAQLIKERGYNITGVCTSNKI
AFLAKELGIKICEINDVDHIDLAIDGADEVDPSLNIIKGGGGALFREKVIDEMASRFVVV
VDETKIVQYLGETFKLPVEVDKFNWYHILRKIESYADIKVERRVNEDVAFITDNGNYILD
CKLPKGIDPYKFHEYLIHLTGVFETGYFLDMADQVIVGTQEGVKILEK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcaaagcactcaagttaatgacattaaatgatgttttaagtcaaatcaat
ggtgacatgacgctgggaattggtacaggaagtacaatggaattactcttacctcaaatg
gcgcaactaattaaagaacgtggttacaatattacaggtgtatgcacttctaataaaatt
gcatttttagcaaaagaattaggtattaaaatatgtgaaatcaatgatgttgatcatatc
gacttagcaattgatggtgctgatgaagtagatccatctttaaatataattaaaggtggc
ggtggtgcgctgttcagagagaaagttatagatgaaatggcatcgcgttttgttgtggtt
gtcgatgaaacgaaaatagttcaatacttaggtgagacgtttaagttaccagtagaggtg
gataaatttaactggtatcacatattacgtaaaattgaatcatacgctgatataaaagta
gaacgtcgtgtaaacgaagatgtcgcatttataactgataatggcaattatattttagat
tgtaagttaccaaaaggaattgacccatataagttccatgagtatttaattcatctgaca
ggtgtgtttgagacaggatacttcttagatatggcagatcaagttattgtaggcactcaa
gagggtgttaaaattttagaaaaataa

DBGET integrated database retrieval system