KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2209
Entry
SA2209            CDS       T00051                                 

Symbol
hlgB
Name
(GenBank) gamma-hemolysin component B
  KO
K11038  leukocidin/hemolysin toxin family protein
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:sau00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    SA2209 (hlgB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sau02000]
    SA2209 (hlgB)
   02042 Bacterial toxins [BR:sau02042]
    SA2209 (hlgB)
Transporters [BR:sau02000]
 Other transporters
  Pores ion channels [TC:1]
   SA2209 (hlgB)
Bacterial toxins [BR:sau02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Beta-pore-forming/Cholesterol-dependent
   SA2209 (hlgB)
SSDB
Motif
Pfam: Leukocidin fn3
Other DBs
NCBI-ProteinID: BAB43511
NITE: SA2209
UniProt: P0A075
Position
2480371..2481348
AA seq 325 aa
MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV
NVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLS
RNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMP
LLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTF
KSTYEIDWENHKVKLLDTKETENNK
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaaaatgaataaattagtcaaatcatccgttgctacatctatggcattattattactt
tctggtactgctaatgctgaaggtaaaataacaccagtcagcgtaaaaaaagtcgatgac
aaagttactttatacaaaacaacagccacagcagattctgataagtttaaaatttcacag
attttaacatttaatttcatcaaagataaaagttatgataaagatactttagtacttaaa
gctactgggaatattaactcaggctttgtgaaacctaatcctaatgactatgacttttca
aaattatattggggagctaaatacaatgtatctataagctcacaatctaatgattcagta
aacgtcgttgattatgcaccaaaaaatcaaaatgaagagtttcaagttcaaaatacttta
ggctatacatttggtggtgacattagtatctctaatggtttatctggtggacttaatgga
aatacagctttttctgaaacaattaattataaacaagaaagttacagaacaacattaagt
cgcaacacaaattataaaaatgttggctggggagttgaagcacataaaattatgaataat
ggttggggaccttatggaagagatagcttccacccaacatatggtaatgaactcttctta
gctggcagacaaagcagtgcatacgctggccaaaacttcatagcgcaacaccaaatgcca
ttattatctagaagtaacttcaatccagaatttttaagcgtactatcacacagacaagat
ggcgctaaaaaatctaaaattacagtaacttatcaacgtgaaatggatttataccaaatt
cgttggaatggcttctactgggcaggcgcaaattataaaaactttaaaactagaacattt
aaatcaacatatgaaattgattgggaaaatcacaaagtgaaattgttagatacaaaagaa
actgaaaacaataaatag

DBGET integrated database retrieval system