KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2290Help
Entry
SA2290            CDS       T00051                                 

Gene name
fnbB
Definition
(GenBank) ORFID:SA2290; fibronectin-binding protein homolog
  KO
K13733  fibronectin-binding protein B
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:sau00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    SA2290 (fnbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SdrG_C_C Fn_bind Big_8 Gram_pos_anchor YSIRK_signal DUF2072
Motif
Other DBs
NCBI-ProteinID: BAB43593
NITE: SA2290
UniProt: A0A0H3JP14
Position
complement(2568323..2571208)
Genome map
AA seq 961 aa AA seqDB search
MKSNLRYGIRKHKLGAASVFLGTMIVVGMGQEKEAAASEQNNTTVEESGSSATESKASET
QTTTNNVNTIDETQSYSATSTEQPSKSTQVTTEEAPTTVQAPKVETEMKSQEDLPSEKVA
DKETTGTQVDIAQPSNVSEIKPRMKRSADVTAVSEKEVAEEAKATGTDVTNKVEVTESSL
EGHNKDSNIVNPHNAQRVTLKYKWKFGEGIKAGDYFDFTLSDNVETHGISTLRKVPEIKS
STEDKVMANGQVINERTIRYTFTDYINNKKDLTAELNLNLFIDPTTVTKQGSQKVEVTLG
QNKVSKEFDIKYLDGVKDRMGVTVNGRIDTLNKEEGKFSHFAYVKPNNQSLTSVTVTGQV
TSGYKQSANNPTVKVYKHIGSDELAESVYAKLDDTSKFEDVTEKVNLSYTSNGGYTLNLG
DLDNSKDYVIKYEGEYDQNAKDLNFRTHLSGYHKYYPYYPYYPYYPVQLTWNNGVAFYSN
NAKGDGKDKPNDPIIEKSEPIDLDIKSEPPVEKHELTGTIEESNDSKPIDFEYHTAVEGA
EGHAEGIIETEEDSIHVDFEESTHENSKHHADVVEYEEDTNPGGGQVTTESNLVEFDEES
TKGIVTGAVSDHTTVEDTKEYTTESNLIELVDELPEEHGQAQGPIEEITENNHHISHSGL
GTENGHGNYGVIDEIEENSHVDIKSELGYEGGQNSGNQSFEEDTEEDKPKYEQGGNIVDI
DFDSVPQIHGQNNGNQSFEEDTEEDKPKYEQGGNIIDIDFDSVPQIHGFNKHNEIIEEDT
NKDKPNYQFGGHNSVDFEEDTLPKVSGQNEGQQTIEEDTTPPTPPTPEVPSEPETPTPPT
PEVPSEPGEPTPPKPEVPSEPETPVPPTPEVPSEPGKPVPPAKEEPKKPSKPVEQGKVVT
PVIEINEKVKAVAPTKQKQSKKSELPETGGEESTNKGMLFGGLFSILGLVLLRRNKKNNK
A
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagcaatcttagatacggcataagaaaacacaaattgggagcggcctcagtattc
ttaggaacaatgatcgttgttggaatgggacaagaaaaagaagctgcagcatcggaacaa
aacaatactacagtagaggaaagtgggagttcagctactgaaagtaaagcaagcgaaaca
caaacaactacaaataacgttaatacaatagatgaaacacaatcatacagcgcgacatca
actgagcaaccatcaaaatcaactcaagtaacaacagaagaagcaccaacaactgtgcaa
gcaccaaaagtagaaaccgaaatgaaatcacaagaagatttaccatcagaaaaagttgct
gataaggaaactacaggaactcaagttgacatagctcaaccaagtaacgtctcagaaatt
aaaccaagaatgaaaagatcagctgacgttacagcagtttcagagaaagaagtagcggaa
gaagctaaagcgacaggtacagatgtaacaaataaagtggaagttactgaaagctcttta
gaaggacataataaagattcgaatattgttaatccgcataatgctcaaagagtaacttta
aaatacaaatggaaatttggagaaggaattaaggcaggagattattttgatttcacatta
agtgataatgttgaaacacatggtatatcaacactgcgtaaagttccggagataaaaagt
tcaacagaagataaagttatggcaaatggtcaagttataaatgaacgtacaattcgctat
acatttactgattatataaataacaaaaaagatttaactgctgaattaaacttaaaccta
ttcattgacccaacaacagtgacaaagcaagggagtcaaaaagttgaagtaacactaggt
caaaataaagtctcaaaagaatttgatatcaaatatttagacggcgttaaagatagaatg
ggtgttactgttaatggtcgtattgatactttgaataaagaagagggtaaatttagccat
tttgcatatgtgaagcctaacaaccagtcgttaacttctgtcacagtaactggtcaagta
acatctggatataaacaaagtgctaataatccaacagtcaaagtatataaacacattggt
tcagatgaattagctgaaagtgtttatgcaaagcttgatgataccagtaaatttgaagat
gtgactgaaaaagtaaatctatcttacacaagtaatggtgggtacacattgaaccttggc
gatttagataattcgaaagactatgtaattaaatatgaaggtgaatatgatcaaaatgct
aaggatctaaatttccgaacacatctttcaggatatcataaatactacccatactatcct
tattacccgtattatccagttcaattaacttggaacaacggtgttgcattttactctaat
aatgctaaaggcgatggtaaagataaaccaaatgatcctatcattgagaagagtgaacca
attgatttagacattaaatcagagccaccagtggagaagcatgaattgactggtacaatc
gaagaaagtaacgattctaagccaattgattttgaatatcatacagctgttgaaggtgca
gaaggtcatgcagaaggtattattgaaactgaagaagattctattcatgtggattttgaa
gaatctacacatgaaaattcaaaacatcacgctgatgttgttgaatatgaagaggataca
aacccaggtggtggccaagtaacaactgagtctaacttagttgaatttgacgaagagtct
acaaaaggtattgtaactggcgcagtgagcgaccatacaacagttgaagatacgaaagaa
tatacaactgaaagtaatctgattgaattagtggatgaattacctgaagaacatggtcaa
gcacaagggccaatcgaggaaattactgaaaacaatcatcatatttctcattctggttta
ggaactgaaaatggtcacggtaattatggcgtgattgatgaaatcgaagaaaatagccac
gttgatattaagagtgaattaggttatgaaggtggccaaaatagcggtaatcagtcattc
gaggaagacacagaagaagataaacctaaatatgaacaaggtggtaatatcgtagatatc
gatttcgacagtgtacctcaaattcatggtcaaaataatggtaaccagtcattcgaggaa
gacacagaagaagacaagcctaagtatgaacaaggtggtaacatcattgatatcgacttc
gacagtgtgccacaaattcatggattcaataagcataatgaaattattgaagaagataca
aacaaagataaacctaattatcaatttggtggacacaacagtgttgattttgaagaagat
acacttccaaaagtaagtggtcaaaatgaaggtcaacaaacgattgaagaagatacaacg
ccgccaacaccgccaacaccagaggtaccaagtgagccggaaacaccaacaccaccaaca
ccagaagtaccgagtgagccaggcgaaccaacgccaccaaaaccggaagtaccaagtgag
ccggaaacaccagtaccaccaacaccagaggtaccatctgaacctggtaaaccagtacca
cctgctaaagaagaacctaaaaaaccttctaaaccagtggaacaaggtaaggtagtaaca
cctgttattgaaatcaatgaaaaggttaaagcagtggcaccaactaaacaaaaacaatct
aagaaatctgaactacctgaaacaggtggagaagaatcaacaaacaaaggtatgttgttc
ggcggattattcagcattctaggtttagtattattacgcagaaataaaaagaataacaaa
gcataa

DBGET integrated database retrieval system