KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA2346Help
Entry
SA2346            CDS       T00051                                 

Definition
(GenBank) ORFID:SA2346; hypothetical protein, similar to D-specific D-2-hydroxyacid dehydrogenase ddh homolog
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00620  Pyruvate metabolism
sau01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA2346
Enzymes [BR:sau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     SA2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N IlvN 3HCDH_N Gp_dh_N UDPG_MGDP_dh_C AlaDh_PNT_C DpaA_N GFO_IDH_MocA PglD_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAB43650
NITE: SA2346
UniProt: A0A0H3JRY1
Position
complement(2635605..2636603)
Genome map
AA seq 332 aa AA seqDB search
MTKIKIMSVRDEDMPYIKAWAEKHHVEVDITKEALTDDNVEGVAGYDGLSLSQQIPLSEH
VYKRLNELGIKQIAQRSAGFDTYDLELANKYNLIVSNVPSYSPNSIAEFAVNQAINVVRH
FNQIQTKVREHDFRWEPTILSKSIKDLKVAVIGTGRIGRVVADIFANGYQSDVVAYDPFP
NAKIATYVDYKDTIEEAVEGADIVTLHVPATKYNHYLFNAELFKHFKKGAVFVNCARGSL
VDTKALLDALDNGVIKGAALDTYEFERKLFPSDQRGKTPNDPLLESLIDREDVILTPHIA
FYTEAAVKNLIVDALDATLDVLQTGDTRLRVN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattaaaatcatgagtgtacgtgatgaagatatgccttatatcaaggcgtgg
gcagagaaacatcatgttgaggtagatattactaaagaagcattaactgatgacaatgtt
gaaggtgtcgctggttatgatggcttatcgctatcacaacaaataccattatcagagcat
gtttataaacgattaaatgaactaggtattaaacaaatcgcacaacgtagtgctggattt
gatacatatgatttggagttagcaaacaagtataacttgattgtgtcaaatgtgccgtca
tactctccgaattcaattgcggagtttgctgtgaaccaggctattaatgtggttcgtcat
tttaatcaaattcaaacgaaagtgcgggagcatgattttagatgggaacctactatttta
tcgaaatccattaaagatttaaaagtagctgttattggtacaggtcgaattggccgtgta
gtagccgatatatttgccaatggttatcaaagtgatgtggtcgcatacgacccgtttcct
aatgctaaaattgcaacgtatgtcgattacaaagatacgattgaggaagcggttgaaggt
gctgatatcgtgacattacatgtacctgcaacgaaatataatcattatctatttaatgct
gaattatttaaacattttaaaaagggcgcagtatttgtcaattgtgcgagaggttcttta
gtagatactaaggcgttattagacgcattagacaatggtgtgattaaaggtgcagcactt
gatacgtatgaatttgaacgcaaacttttcccaagtgatcaaaggggcaaaacaccgaac
gatccattgttagaatcgttgattgacagggaagatgtcatattaacaccacatattgcg
ttttatactgaagctgcagttaaaaatctaattgtcgatgcattagatgcaacattagat
gtattgcagactggagatactaggttacgagtaaattaa

DBGET integrated database retrieval system