KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SAS076
Entry
SAS076            CDS       T00051                                 

Definition
(GenBank) ORFID:SAS076; hypothetical protein, similar to transposase for IS232
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
SSDB
Other DBs
NCBI-ProteinID: BAB43305
NITE: SAS076
UniProt: A0A0H3JVG4
Position
complement(2287213..2287368)
AA seq 51 aa
MNVRNSYKVKHKYLKVNRSNMITYKSNQYSASAEYCGKTVEVQVYDQKQHV
NT seq 156 nt   +upstreamnt  +downstreamnt
gtgaatgtaagaaactcatataaagtgaaacataaatatttgaaagtcaaccgctctaat
atgattacatataagtccaatcaatattcagcatcagctgaatattgtgggaaaacagtt
gaagttcaagtttatgatcaaaaacaacacgtttaa

DBGET integrated database retrieval system