KEGG   Staphylococcus aureus subsp. aureus 55/2053: SAAG_00997Help
Entry
SAAG_00997        CDS       T02810                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase vraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saua  Staphylococcus aureus subsp. aureus 55/2053
Pathway
saua00071  Fatty acid degradation
saua00072  Synthesis and degradation of ketone bodies
saua00280  Valine, leucine and isoleucine degradation
saua00310  Lysine degradation
saua00362  Benzoate degradation
saua00380  Tryptophan metabolism
saua00620  Pyruvate metabolism
saua00630  Glyoxylate and dicarboxylate metabolism
saua00640  Propanoate metabolism
saua00650  Butanoate metabolism
saua00900  Terpenoid backbone biosynthesis
saua01100  Metabolic pathways
saua01110  Biosynthesis of secondary metabolites
saua01120  Microbial metabolism in diverse environments
saua01130  Biosynthesis of antibiotics
saua01200  Carbon metabolism
saua01212  Fatty acid metabolism
saua02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAAG_00997
   00630 Glyoxylate and dicarboxylate metabolism
    SAAG_00997
   00640 Propanoate metabolism
    SAAG_00997
   00650 Butanoate metabolism
    SAAG_00997
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAAG_00997
   00072 Synthesis and degradation of ketone bodies
    SAAG_00997
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAAG_00997
   00310 Lysine degradation
    SAAG_00997
   00380 Tryptophan metabolism
    SAAG_00997
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAAG_00997
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAAG_00997
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAAG_00997
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saua04147]
    SAAG_00997
Enzymes [BR:saua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAAG_00997
Exosome [BR:saua04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAAG_00997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: EEV04386
Position
532715..533854
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYGVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGELFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFDHGLLFKDGVTVGVDSNLPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKESM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgctcaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggctcaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatt
caagccggagctggcaaggtatatattgcaggcggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaaccgcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtagcc
aagatgtatggtgtttcaagagaattacaagatgaatttgcttaccgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaactattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttctattgcttattatggaaaaagatatggcatacgaattaggtttcgat
catggtttattatttaaagatggtgttacggtaggtgttgattctaatttacctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtggttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgacgcgattattttatatgtttgacaaagagagtatg
attgcatctatggggattgggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system