KEGG   Staphylococcus aureus subsp. aureus 55/2053: SAAG_01436Help
Entry
SAAG_01436        CDS       T02810                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
saua  Staphylococcus aureus subsp. aureus 55/2053
Pathway
saua00900  Terpenoid backbone biosynthesis
saua01100  Metabolic pathways
saua01110  Biosynthesis of secondary metabolites
saua01130  Biosynthesis of antibiotics
Module
saua_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:saua00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAAG_01436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:saua01006]
    SAAG_01436
Enzymes [BR:saua01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SAAG_01436
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SAAG_01436
    2.5.1.29  geranylgeranyl diphosphate synthase
     SAAG_01436
Prenyltransferases [BR:saua01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SAAG_01436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: EEV03487
Structure
PDB: 

Position
complement(1540510..1541376)
Genome map
AA seq 288 aa AA seqDB search
MNKLIDEVNNELSVAINKSVMNTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTEYELGM
KSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAFELISS
DDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGALLTFA
VMSAADIANVDDATKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLENNKSTY
VSLLGKDGAEDKLTYHRDAAVDELMQIDEQFNTKHLLEIVDLFYSRDH
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattaatagatgaagtcaataatgaattatcggttgcgataaataaatcagta
atgaatactcagctagaagaaagtatgttgtattcattaaatgctggaggtaaacgcatc
cgaccagttctgttattactcactttagattcactaaataccgagtatgagttaggtatg
aagagcgcaattgcactagaaatgattcatacatattcacttattcatgatgacctacca
gcgatggataatgatgattatcgacgagggaaattaacgaatcataaagtatatggtgag
tggacggcgatattagcaggtgatgctttattaactaaagcatttgaacttatttcaagt
gatgatagattaactgatgaagtaaaaataaaagttctacaacggctgtcaatagcaagt
ggtcatgttggaatggtcggcggtcaaatgttagatatgcaaagcgaaggccaaccaatt
gatcttgaaactttggaaatgatacacaaaacaaaaacaggagcactattaacttttgcg
gttatgagtgcagcagatatcgctaatgtcgatgatgcaactaaagaacatttagaaagt
tatagttatcatttaggtatgatgtttcagattaaagatgatttattagactgctatggt
gatgaagcgaagttaggtaaaaaagtgggcagcgatcttgaaaataataaaagtacgtac
gtgagtttattaggaaaagatggcgcagaagataaattgacttatcatagagacgcagca
gtggatgaactaatgcaaattgatgaacaattcaatacaaaacacttattagaaatcgtt
gatttattttatagcagggatcactaa

DBGET integrated database retrieval system