KEGG   Staphylococcus aureus 08BA02176 (LA-MRSA): C248_0105Help
Entry
C248_0105         CDS       T02339                                 

Definition
(GenBank) putative ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
saub  Staphylococcus aureus 08BA02176 (LA-MRSA)
Pathway
saub00998  Biosynthesis of secondary metabolites - other antibiotics
saub00999  Biosynthesis of secondary metabolites - unclassified
saub01100  Metabolic pathways
Module
saub_M00875  Staphyloferrin B biosynthesis, L-serine => staphyloferrin B
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    C248_0105
   00999 Biosynthesis of secondary metabolites - unclassified
    C248_0105
Enzymes [BR:saub01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     C248_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP Ig_3 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AFR72119
Structure
PDB: 

Position
111131..112141
Genome map
AA seq 336 aa AA seqDB search
MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagagatgttgtatttaaatagatcagatattgaacaagcgggaggaaatcat
tcacaagtttatgtggacgcattaacagaagcattaacagcgcatgcgcacaatgatttt
gtacaaccgcttaagccgtatttaagacaggatcctgaaaatggacacatcgcagatcga
attattgcaatgccaagtcatatcggtggtgaacacgcaatttcaggtattaagtggata
ggtagtaagcacgacaatccatcgaaacgtaatatggagcgtgcaagtggtgtcattatt
ttgaatgatccagaaacgaattatccaattgcagttatggaagcaagtttaattagtagt
atgcgtactgcagcagtttcagtgattgcagctaagcatttggctaaaaaaggatttaaa
gacttaacaatcattggttgcgggctaatcggagacaagcaattacaaagtatgttagag
caattcgatcatattgaacgcgtgtttgtttacgatcaattctctgaagcgtgtgcacgc
tttgttgatagatggcaacaacagcgtccggaaattaattttattgcgacagaaaatgct
aaagaagcagtatcaaatggtgaagtagtcattacatgtaccgtaacggatcaaccatat
attgaatatgattggttacaaaagggtgcatttattagcaacatttctatcatggatgtg
cataaagaagtctttattaaagctgacaaagtcgtagtagatgactggtcacaatgtaat
cgagaaaagaaaactattaaccaattggtgttagaaggtaaattcagcaaagaagcactt
catgctgaacttgggcaacttgtgacaggtgacataccaggacgtgaagacgatgatgaa
atcatattacttaatccgatgggtatggctatcgaagatatttcaagtgcttactttatt
tatcaacaggcacaacaacaaaatattgggacaacattgaacctatattaa

DBGET integrated database retrieval system