KEGG   Staphylococcus aureus 08BA02176: C248_0409Help
Entry
C248_0409         CDS       T02339                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saub  Staphylococcus aureus 08BA02176
Pathway
saub00071  Fatty acid degradation
saub00072  Synthesis and degradation of ketone bodies
saub00280  Valine, leucine and isoleucine degradation
saub00310  Lysine degradation
saub00362  Benzoate degradation
saub00380  Tryptophan metabolism
saub00620  Pyruvate metabolism
saub00630  Glyoxylate and dicarboxylate metabolism
saub00640  Propanoate metabolism
saub00650  Butanoate metabolism
saub00900  Terpenoid backbone biosynthesis
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01120  Microbial metabolism in diverse environments
saub01130  Biosynthesis of antibiotics
saub01200  Carbon metabolism
saub01212  Fatty acid metabolism
saub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C248_0409 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    C248_0409 (thl)
   00640 Propanoate metabolism
    C248_0409 (thl)
   00650 Butanoate metabolism
    C248_0409 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C248_0409 (thl)
   00072 Synthesis and degradation of ketone bodies
    C248_0409 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C248_0409 (thl)
   00310 Lysine degradation
    C248_0409 (thl)
   00380 Tryptophan metabolism
    C248_0409 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C248_0409 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C248_0409 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C248_0409 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saub04147]
    C248_0409 (thl)
Enzymes [BR:saub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C248_0409 (thl)
Exosome [BR:saub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C248_0409 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFR72422
Position
425209..426390
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPAIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPSEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcagtcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatcctgctattatgggtattgccccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagtgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattaccttctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaaatataaataa

DBGET integrated database retrieval system