KEGG   Staphylococcus aureus 08BA02176 (LA-MRSA): C248_1339Help
Entry
C248_1339         CDS       T02339                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
saub  Staphylococcus aureus 08BA02176 (LA-MRSA)
Pathway
saub00480  Glutathione metabolism
saub00590  Arachidonic acid metabolism
saub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C248_1339
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C248_1339
Enzymes [BR:saub01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C248_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFR73329
Position
complement(1351647..1352123)
Genome map
AA seq 158 aa AA seqDB search
METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNK
KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatttatgattttgtagtagaaacaaataaaggtgttacttacaaattagat
gcatataaaggtgacgttatgctaattgtcaatacagctagcgaatgtggctttacttca
caattcgaaggtttgcaatcattatacgagaaatacaaagatcaagggtttgtaattcta
ggtttcccttgtaatcaatttggtggccaagaacctggatcaggcgaagaagcagctcaa
aactgtaaattaaactatggtgttaccttccctatgcatcaaaaaatagacgtaaaaggg
gaacatcaattacctttatttagatatttgactgcggcacaacatggattctttaataag
aaaatcaaatggaatttcactaagtttttagtggatcgtgaaggtaacgttgttaaacga
tttgcacctcaaaaaaaacctgttcaaatcgaaagagaaatagaaaagttattataa

DBGET integrated database retrieval system