KEGG   Staphylococcus aureus 08BA02176 (LA-MRSA): C248_1354Help
Entry
C248_1354         CDS       T02339                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
saub  Staphylococcus aureus 08BA02176 (LA-MRSA)
Pathway
saub00260  Glycine, serine and threonine metabolism
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01120  Microbial metabolism in diverse environments
saub01130  Biosynthesis of antibiotics
saub01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C248_1354
Enzymes [BR:saub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C248_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 SepSecS Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AFR73344
Position
complement(1365732..1366757)
Genome map
AA seq 341 aa AA seqDB search
MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDCPNATIRFLVG
GTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEGKVSASDVETY
METFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPLFMDGARLGYG
LMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRIKHHGALLAKG
RLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFINKGYRLYFDSPTNQQFFILSNEKIA
ELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcatttgaaaatgattatttagaaggtgctcatgaaaaagtattaaaacgatta
gtagatacaaatcttgtacaagcttcgggatatggttttgatcaattcacagctcaggca
attgaaaagattaaagatacaattgattgtccaaatgctactattcgttttttagtaggt
ggaacacaaaccaatcaggttgttattaattcaatgttagaaagttacgaaggggtcatt
tcagcagacactggtcatgttgctgtgcatgagggcggtgcaattgaatatagtggacat
aaagtaattactataccctctaaggaaggaaaagttagtgcttcagatgttgaaacttac
atggagacatttaaaagtgattttaaaaaggaccatatggtattcccaggaatggtatat
atttctcatcctacagaatatggcacattatactctaaatcagaattggaagagttatgc
aaagtatgtaagcaatatcagcttccattatttatggatggtgcacgattagggtatgga
ttgatgagtgatcaatcagatatgaccattaaagacatcgctaaatattgtgatgtattt
tatataggtggtacgaagataggtgcattatgcggagaagcaattgtttttacgaagaat
aatgaaccgaaacaatttaccactcgaatcaaacatcacggtgcccttttagcaaaagga
cggttaacaggcatacaatttttagaattatttacggataatttatattttaatataagc
agacatgctatcgaaatggcaaataagatgaaagacgggtttataaataaaggctatcgt
ctttactttgattctccaaccaatcaacaattttttattttaagtaacgagaaaatagca
gagttagaacaaaaagttaaatttgctgtttgggaaaaatacgatgatcaacatcgtgtt
gttagattcgcaaccagttgggcgacaaccgaagaaaatttaaataaactattagaatta
atctaa

DBGET integrated database retrieval system