KEGG   Staphylococcus aureus 08BA02176 (LA-MRSA): C248_1564Help
Entry
C248_1564         CDS       T02339                                 

Definition
(GenBank) putative geranyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
saub  Staphylococcus aureus 08BA02176 (LA-MRSA)
Pathway
saub00900  Terpenoid backbone biosynthesis
saub01100  Metabolic pathways
saub01110  Biosynthesis of secondary metabolites
saub01130  Biosynthesis of antibiotics
Module
saub_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:saub00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C248_1564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:saub01006]
    C248_1564
Enzymes [BR:saub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     C248_1564
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     C248_1564
    2.5.1.29  geranylgeranyl diphosphate synthase
     C248_1564
Prenyltransferases [BR:saub01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   C248_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AFR73554
Structure
PDB: 

Position
complement(1609761..1610642)
Genome map
AA seq 293 aa AA seqDB search
MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTK
HELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPINLETLEMIHKTKTGA
LLTFAVMSAADIANVDDATKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
NKSTYVSLLGKDGAEDKLTYHRDAAVDELMQIDEQFNTKHLLEIVDLFYSRDH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatctaccgatgaataaattaatagatgaagtcaataatgaattatcggttgcg
ataaataaatcagtaatggatactcagctagaagaaagtatgttgtattcattaaatgct
ggaggtaaacgcatccgaccagttctgttattacttactttagattcactaaataccaag
catgagttaggtatgaagagcgcaattgcactagaaatgattcatacatattcacttatt
catgatgacctaccagcgatggataatgatgattatcgacgagggaaattaacaaatcat
aaagtatatggtgagtggacggcgatattagcaggtgatgctttattaactaaagcattt
gaacttatttcaagtgatgatagattaactgatgaagtaaaaataaaagttctacaacgg
ctgtcaatagcaagtggtcatgttggaatggttggcggtcaaatgttagatatgcaaagc
gaaggccaaccaattaatcttgaaactttggaaatgatacacaaaacaaaaacaggagca
ctattaacttttgcggttatgagtgcagcagatatcgctaatgtcgatgatgcaactaaa
gaacatttagaaagttatagttatcatttaggtatgatgtttcagattaaagatgattta
ttagactgctatggtgatgaagcgaagttaggtaaaaaagtgggcagcgatcttgaaaat
aataaaagtacatacgtgagtttattaggaaaagatggcgcagaagataaattgacttat
catagagacgcagcagtggatgaactaatgcaaattgatgaacaattcaatacaaaacac
ttattagaaatcgttgatttattttatagcagggatcactaa

DBGET integrated database retrieval system