KEGG   Staphylococcus aureus CA-347 (MRSA): CA347_128Help
Entry
CA347_128         CDS       T02702                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sauc  Staphylococcus aureus CA-347 (MRSA)
Pathway
sauc00998  Biosynthesis of secondary metabolites - other antibiotics
sauc00999  Biosynthesis of secondary metabolites - unclassified
sauc01100  Metabolic pathways
Module
sauc_M00875  Staphyloferrin B biosynthesis, L-serine => staphyloferrin B
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    CA347_128
   00999 Biosynthesis of secondary metabolites - unclassified
    CA347_128
Enzymes [BR:sauc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     CA347_128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH GFO_IDH_MocA Sacchrp_dh_NADP Ig_3 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGO28506
Structure
PDB: 

Position
141526..142536
Genome map
AA seq 336 aa AA seqDB search
MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagagatgttgtatttaaatagatcagatattgaacaagcgggaggtaatcat
tcacaagtttatgtggacgcattaacagaagcattaacagcgcatgcgcacaatgatttt
gtacaaccgcttaagccgtatttaagacaggatcctgaaaatggacacatcgcagatcga
attattgcaatgccaagtcatatcggtggtgaacacgcaatttcaggtattaagtggata
ggtagtaagcacgacaatccatcgaaacgtaatatggagcgtgcaagtggtgtcattatt
ttgaatgatccagaaacgaattatccaattgcagttatggaagcaagtttaattagtagt
atgcgtactgcagcagtttcagtgattgcagctaagcatttggctaaaaaaggatttaaa
gacttaacaatcattggatgcgggctaatcggagacaagcaattacaaagtatgttagag
caattcgatcatattgaacgcgtgtttgtttacgatcaattctctgaagcgtgtgcacgc
tttgttgatagatggcaacaacagcgtccggaaattaattttattgcgacagaaaatgct
aaagaagcagtatcaaatggtgaagtagtcattacatgtaccgtaacggatcaaccatac
attgaatatgattggttacaaaagggtgcatttattagcaacatttctatcatggatgtg
cataaagaagtctttattaaagctgacaaagtcgtagtagacgactggtcacaatgtaat
cgagaaaagaaaactattaaccaattggtgttagaaggtaaattcagcaaagaagcactt
catgctgaactaggacaacttgtgacaggtgacataccaggacgtgaagacgatgatgaa
atcatattacttaatccgatgggtatggctatcgaagatatttcaagtgcttactttatt
tatcaacaggcacaacaacaaaatattgggacaacattgaacctatattaa

DBGET integrated database retrieval system