KEGG   Staphylococcus aureus CA-347 (MRSA): CA347_2682Help
Entry
CA347_2682        CDS       T02702                                 

Gene name
fda
Definition
(GenBank) fructose-bisphosphate aldolase class 1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
sauc  Staphylococcus aureus CA-347 (MRSA)
Pathway
sauc00010  Glycolysis / Gluconeogenesis
sauc00030  Pentose phosphate pathway
sauc00051  Fructose and mannose metabolism
sauc00680  Methane metabolism
sauc01100  Metabolic pathways
sauc01110  Biosynthesis of secondary metabolites
sauc01120  Microbial metabolism in diverse environments
sauc01130  Biosynthesis of antibiotics
sauc01200  Carbon metabolism
sauc01230  Biosynthesis of amino acids
Module
sauc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sauc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA347_2682 (fda)
   00030 Pentose phosphate pathway
    CA347_2682 (fda)
   00051 Fructose and mannose metabolism
    CA347_2682 (fda)
  09102 Energy metabolism
   00680 Methane metabolism
    CA347_2682 (fda)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sauc04131]
    CA347_2682 (fda)
   03036 Chromosome and associated proteins [BR:sauc03036]
    CA347_2682 (fda)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauc04147]
    CA347_2682 (fda)
Enzymes [BR:sauc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CA347_2682 (fda)
Membrane trafficking [BR:sauc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CA347_2682 (fda)
Chromosome and associated proteins [BR:sauc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    CA347_2682 (fda)
Exosome [BR:sauc04147]
 Exosomal proteins
  Proteins found in most exosomes
   CA347_2682 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic Hist_deacetyl Clp_N GD_AH_C
Motif
Other DBs
NCBI-ProteinID: AGO30972
Position
2721606..2722496
Genome map
AA seq 296 aa AA seqDB search
MNKEQLEKMKNGKGFIAALDQSGGSTPKALKEYGVNEDQYSNEDEMFQLVHDMRTRVVTS
PSFSPDKILGAILFEQTMDREVEGKYTADYLADKGVVPFLKVDKGLAEEQNGVQLMKPID
NLDSLLDRANERHIFGTKMRSNILELNEQGIKDVVEQQFEVAKQIIAKGLVPIIEPEVNI
NAKDKAEIEKVLKAELKKGLDSLNADQLVMLKLTIPTEANLYKDLAEHPNVVRIVVLSGG
YSREKANELLKDNAELIASFSRALASDLRAGQSKEEFDKALGDAVESIYDASVNKN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagagcaattagaaaaaatgaaaaatggaaaaggctttattgccgcattagac
caaagtggtggtagtacaccaaaagcacttaaagaatatggtgtaaacgaagatcaatat
agcaatgaagacgaaatgttccaacttgttcacgatatgcgtacacgtgtggtaacttca
ccttcattctcaccagataaaattttgggtgctattcttttcgaacaaacaatggatcgc
gaagtagaaggcaaatacactgcagattacttagctgataaaggtgttgttccgttctta
aaagtagacaaaggtcttgctgaagagcaaaatggtgttcaattaatgaaaccaatcgac
aacttagacagcttattagatcgtgcaaacgagcgtcacatttttggtacaaaaatgcgt
tctaatattttagaattaaatgaacaaggtatcaaagacgttgttgaacaacaatttgaa
gtcgctaaacaaattattgctaaagggttagtgccaattatcgaaccagaagttaatatt
aacgcaaaagataaagctgaaattgaaaaagtattaaaagctgagcttaaaaaaggttta
gacagcttaaatgctgatcaattagttatgttaaaattaacaattcctactgaagctaac
ttatacaaagacttagctgaacatccaaatgttgttcgtatcgttgtattatcaggtggt
tacagcagagaaaaagcgaacgaattacttaaagataacgctgaacttatcgcaagcttc
tcacgtgcattagctagtgatttaagagctggacaatctaaagaagaattcgataaagca
ttaggtgacgctgtagaatcaatctacgacgcatctgtaaacaaaaactaa

DBGET integrated database retrieval system