KEGG   Staphylococcus aureus CA-347: CA347_367Help
Entry
CA347_367         CDS       T02702                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sauc  Staphylococcus aureus CA-347
Pathway
sauc00071  Fatty acid degradation
sauc00072  Synthesis and degradation of ketone bodies
sauc00280  Valine, leucine and isoleucine degradation
sauc00310  Lysine degradation
sauc00362  Benzoate degradation
sauc00380  Tryptophan metabolism
sauc00620  Pyruvate metabolism
sauc00630  Glyoxylate and dicarboxylate metabolism
sauc00640  Propanoate metabolism
sauc00650  Butanoate metabolism
sauc00900  Terpenoid backbone biosynthesis
sauc01100  Metabolic pathways
sauc01110  Biosynthesis of secondary metabolites
sauc01120  Microbial metabolism in diverse environments
sauc01130  Biosynthesis of antibiotics
sauc01200  Carbon metabolism
sauc01212  Fatty acid metabolism
sauc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA347_367 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    CA347_367 (thlA)
   00640 Propanoate metabolism
    CA347_367 (thlA)
   00650 Butanoate metabolism
    CA347_367 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CA347_367 (thlA)
   00072 Synthesis and degradation of ketone bodies
    CA347_367 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CA347_367 (thlA)
   00310 Lysine degradation
    CA347_367 (thlA)
   00380 Tryptophan metabolism
    CA347_367 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CA347_367 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CA347_367 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CA347_367 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sauc04147]
    CA347_367 (thlA)
Enzymes [BR:sauc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CA347_367 (thlA)
Exosome [BR:sauc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CA347_367 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGO28745
Position
408243..409424
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPIVVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMILVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcgttgtcactaaggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatattagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggtgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagtgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaaatataaataa

DBGET integrated database retrieval system