KEGG   Staphylococcus aureus CA-347 (MRSA): CA347_678Help
Entry
CA347_678         CDS       T02702                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sauc  Staphylococcus aureus CA-347 (MRSA)
Brite
KEGG Orthology (KO) [BR:sauc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CA347_678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGO29036
Position
724472..725479
Genome map
AA seq 335 aa AA seqDB search
MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTAILMAAVMNFIGALTF
TGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIPSSSSHALIGSIAGAAI
ASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIFKNANLTRANRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLWVKFACATAMGLGTAIGGW
KIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWSTAQRMIITWVITLPISALLAGLLFYILNLFF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatataatcatcgtcactatagctgtagttattttctcgctgatatttgacttt
atcaatggattccatgatacagccaatgcagtagctactgctgtatctactagagcgtta
acgcctaaaacggcaattttaatggcagcagtgatgaactttataggtgctttaacattt
acgggcgttgcaggcaccattactaaagacattgtcgatccatttaaattggaaaatgga
ttagttgttgtgttagctgcaatacttgcggctattatttggaatttagctacttggttt
tacggaattccaagttcgtcttcacatgcacttataggttcaattgcgggtgcagcaatc
gcatctgaaggctcatttggcgtattacattaccaaggtttcacaaaaattattattgta
ttaatcgtgtcaccgattatcgcattttgtgttggtttcttgatgtattcaatttttaaa
gttatctttaaaaatgcaaatttaacaagagcgaatcgtaactttagatttttccaaatt
ttcacagcagcgttacaatcattctctcacggtaccaatgatgcacaaaaatcaatgggt
attattacgttggcattgattgttgctaatgtacagaatgatggcagcgttgaaccacag
ttatgggtaaaatttgcctgtgcaacagcaatggggcttggtactgcaattggtggctgg
aaaattatcaaaactgtaggtggtaatattatgaaaatacgtccagcaaatggtgctgcg
gccgatttatcatctgcattaacaatttttgttgcatcatcgctacatttcccattatca
acaactcacgttgtgtcatcatcaatcttaggtgttggtgcttctaaccgagctaaaggt
gtaaaatggagtactgcgcaacgaatgatcattacatgggtgatcacattacctatttca
gcattgttagcaggtttactattctatatacttaacttatttttctaa

DBGET integrated database retrieval system