KEGG   Staphylococcus aureus 502A: CH52_02880Help
Entry
CH52_02880        CDS       T03491                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00071  Fatty acid degradation
saud00072  Synthesis and degradation of ketone bodies
saud00280  Valine, leucine and isoleucine degradation
saud00310  Lysine degradation
saud00362  Benzoate degradation
saud00380  Tryptophan metabolism
saud00620  Pyruvate metabolism
saud00630  Glyoxylate and dicarboxylate metabolism
saud00640  Propanoate metabolism
saud00650  Butanoate metabolism
saud00900  Terpenoid backbone biosynthesis
saud01100  Metabolic pathways
saud01110  Biosynthesis of secondary metabolites
saud01120  Microbial metabolism in diverse environments
saud01130  Biosynthesis of antibiotics
saud01200  Carbon metabolism
saud01212  Fatty acid metabolism
saud02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH52_02880
   00630 Glyoxylate and dicarboxylate metabolism
    CH52_02880
   00640 Propanoate metabolism
    CH52_02880
   00650 Butanoate metabolism
    CH52_02880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH52_02880
   00072 Synthesis and degradation of ketone bodies
    CH52_02880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH52_02880
   00310 Lysine degradation
    CH52_02880
   00380 Tryptophan metabolism
    CH52_02880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CH52_02880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH52_02880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH52_02880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saud04147]
    CH52_02880
Enzymes [BR:saud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CH52_02880
Exosome [BR:saud04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CH52_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHM69272
UniProt: A0A2C9TWZ6
Position
complement(536090..537229)
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system