KEGG   Staphylococcus aureus 502A: CH52_08485Help
Entry
CH52_08485        CDS       T03491                                 

Definition
(GenBank) thiaminase
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00730  Thiamine metabolism
saud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CH52_08485
Enzymes [BR:saud01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     CH52_08485
Transcription factors [BR:saud03000]
 Prokaryotic type
  Other transcription factors
   Others
    CH52_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Imm30 FadA SPARC_Ca_bdg
Motif
Other DBs
NCBI-ProteinID: AHM70343
UniProt: A0A0D6H8Z6
Structure
PDB: 

Position
1766237..1766926
Genome map
AA seq 229 aa AA seqDB search
MEFSQKLYQAAKPIINDIYEDDFIQKMLSGDIGADALRHYLKADAAYLKEFTNLYALLIP
KMNSMNDVKFLVEQIEFMVEGEVLAHDILAQIVGESYEEIIKTKVWPPSGDHYIKHMYFQ
AHSRENAIYTIAAMAPCPYIYAELAKRSQSDHKLNREKDTAKWFDFYSTEMDDIINVFEA
LMNKLAESMSDKELEQVKQVFLESCIHERRFFNMAMTLEQWEFGGKVND
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcacaaaaattgtaccaagctgcaaagccaatcattaatgatatttatgag
gatgactttattcagaagatgttatccggagatataggagctgacgcattacgccattac
ttaaaagctgatgctgcgtatttaaaagaatttacaaacttatatgctttgttaattcca
aaaatgaatagcatgaatgacgtaaaatttttagtagagcaaatagaatttatggttgaa
ggtgaagtacttgcgcatgatattttagcgcaaattgttggtgaatcatacgaagaaatc
attaaaacaaaagtttggcctccaagtggcgaccattacataaaacatatgtatttccaa
gcgcatagtcgtgaaaatgctatttatacaattgctgcaatggcaccttgtccatatatt
tatgcagaattagctaagcgctctcaaagtgatcataagcttaatagagaaaaagatacg
gcaaaatggtttgatttttatagtactgaaatggatgacataattaacgtatttgaggca
ttaatgaataaattagccgaatcaatgtctgacaaggaattggaacaagtaaagcaagta
tttttagaaagttgcatacatgagcgtcgatttttcaatatggctatgacactagaacaa
tgggaatttggaggaaaagtaaatgattaa

DBGET integrated database retrieval system