KEGG   Staphylococcus aureus 502A: CH52_11385Help
Entry
CH52_11385        CDS       T03491                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00260  Glycine, serine and threonine metabolism
saud00630  Glyoxylate and dicarboxylate metabolism
saud00670  One carbon pool by folate
saud01100  Metabolic pathways
saud01110  Biosynthesis of secondary metabolites
saud01130  Biosynthesis of antibiotics
saud01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CH52_11385
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CH52_11385
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CH52_11385
Enzymes [BR:saud01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CH52_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AHM70849
UniProt: W8TW08
Position
2314068..2315159
Genome map
AA seq 363 aa AA seqDB search
MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
IDK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgatttaaaacaaacacctttatatcaaaattatgttgatagaggtgcaaaa
attgtggaattcggaggatgggcgatgcctgttcaattttcaagtattaaagaggagcat
aatgctgttcgatacgaaattggcctgtttgatgttagtcatatgggtgaaattgaagta
acaggtaaagatgctagtcagtttgtgcaatatttattatcaaatgatactgataattta
actacttcaaaagcattatatactgctttatgtaatgaagaaggcggtattattgatgat
ttagtaatatataaattagctgacgacaattatttattagttgttaatgctgctaatact
gaaaaagattttaattggattttaaaacacaaagagaaatttgatgttgaagtacaaaat
gtatcaaaccaatatggtcaattagcaatacaaggaccaaaagctagagatttaattaat
caattagttgatgaagatgtaactgaaatgaaaatgtttgaatttaaacagggtgtcaaa
ttatttggagcaaacgtcattttatctcagtcaggttacacaggtgaagatgggtttgaa
atttattgtaatatcgatgatactgaaaaaatttgggatggtttattagagtataatgtt
atgccatgtgggttaggcgctcgtgatacattaagattagaggctggattgccattacat
ggacaagatttaactgaatcaattacaccatatgaaggtggtatcgcttttgcaagtaaa
ccattaattgatgctgattttattggtaaatctgtattaaaagatcaaaaagaaaatggt
gcaccaagaagaacagtgggattagaattacttgaaaaaggaattgcaagaactggttat
gaagttatggatttagatggaaatattattggagaagtaacttcaggaacacagtctcca
tcatcaggaaaatcaattgcacttgcaatgataaaaagagatgagtttgaaatgggtaga
gagttgcttgttcaagttcgtaagcgtcaattaaaagcgaaaattgttaagaaaaatcaa
attgataaataa

DBGET integrated database retrieval system