KEGG   Staphylococcus aureus 502A: CH52_11460Help
Entry
CH52_11460        CDS       T03491                                 

Definition
(GenBank) geranyl transferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00900  Terpenoid backbone biosynthesis
saud01100  Metabolic pathways
saud01110  Biosynthesis of secondary metabolites
saud01130  Biosynthesis of antibiotics
Module
saud_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CH52_11460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:saud01006]
    CH52_11460
Enzymes [BR:saud01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CH52_11460
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CH52_11460
    2.5.1.29  geranylgeranyl diphosphate synthase
     CH52_11460
Prenyltransferases [BR:saud01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CH52_11460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AHM70864
UniProt: A0A506TL81
Structure
PDB: 

Position
2327029..2327910
Genome map
AA seq 293 aa AA seqDB search
MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
YELGVKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
LLTFAVMSAADIANVDDATKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatctaccgatgaataaattaatagatgaagtcaataatgaattatcggttgcg
ataaataaatcagtaatggatactcagctagaagaaagcatgttgtattcattaaatgct
ggaggtaaacgcatccgaccagttctgttattactcactttagattcactaaataccgag
tatgagttaggtgtgaagagcgcaattgcactagaaatgattcatacatattcacttatt
catgatgacctaccagcgatggataatgatgattatcgacgagggaaattaacaaatcat
aaagtatatggtgagtggactgcgatattagcaggtgatgctttattaactaaagcattt
gaacttatttcaagtgatgatagattaactgatgaagtaaaaataaaagttctacaacgg
ctgtcaatagcaagtggtcatgttggaatggtcggcggtcaaatgttagatatgcaaagc
gaaggccaaccaattgatcttgaaactttggaaatgatacacaaaacaaaaacaggagca
ttattaacttttgcggttatgagtgcagcagatatcgctaatgtcgatgatgcaactaaa
gaacatttagaaagttatagttatcatttaggtatgatgttccagattaaagatgattta
ttagactgctatggtgatgaagcaaagttaggtaaaaaagtgggcagcgatcttgaaaat
aataaaagtacgtacgtgagtttattagggaaagatggcgcagaagataaattgacttat
catagagacgcagcagtggatgaactaacgcaaattgatgaacaattcaatacaaaacac
ttattagaaatcgttgatttattttatagcagggatcactaa

DBGET integrated database retrieval system