KEGG   Staphylococcus aureus 502A: CH52_12855Help
Entry
CH52_12855        CDS       T03491                                 

Definition
(GenBank) succinyl-CoA synthetase subsunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00020  Citrate cycle (TCA cycle)
saud00640  Propanoate metabolism
saud00660  C5-Branched dibasic acid metabolism
saud01100  Metabolic pathways
saud01110  Biosynthesis of secondary metabolites
saud01120  Microbial metabolism in diverse environments
saud01130  Biosynthesis of antibiotics
saud01200  Carbon metabolism
Module
saud_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saud_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CH52_12855
   00640 Propanoate metabolism
    CH52_12855
   00660 C5-Branched dibasic acid metabolism
    CH52_12855
Enzymes [BR:saud01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CH52_12855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AHM71134
UniProt: A0A0K7NVV8
Position
complement(2657241..2658149)
Genome map
AA seq 302 aa AA seqDB search
MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
NK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttatagataagaatactaaagtaatggtacaaggtattacagggtctact
gcccttttccatacaaaacaaatgcttgattatggtacgaaaatagtagcaggtgtgacg
cctggtaaaggtggtcaagttgttgaaggcgttcctgttttcaacactgttgaagaagct
aaaaatgaaactggggcaacggtttcagtcatttacgttccagcaccatttgctgcagac
tcaattttagaagcagctgatgcagacttagatatggttatttgtatcactgaacatatt
cctgtattagacatggttaaagttaaacgctacttacaaggtagaaaaacacgtttagtt
ggtccgaactgtccaggtgtgattacagcagatgaatgtaaaattggtattatgcctggc
tatattcacaaaaaaggtcatgttggtgtagtatcacgttcaggtacactaacatatgaa
gcagtgcaccaattgactgaagaaggtattggtcaaactacagctgttggtattggtgga
gacccagtcaacggaacaaactttattgatgttttaaaagcattcaatgaagatgacgaa
acgaaagcagttgttatgattggtgaaatcggtggtacagctgaagaagaagcagctgaa
tggattaaagcgaatatgacaaaaccagttgtaggctttatcggtggacaaacagcacct
cctggaaaacgtatgggacatgctggtgcaatcatttcaggtggtaaaggtactgctgaa
gagaaaataaaaacattaaatagttgtggtgtgaaaacagcggcaacaccttcagaaatt
ggttcaacattaattgaagctgctaaagaagcaggtatttatgaatcattattaacagtt
aataaataa

DBGET integrated database retrieval system