KEGG   Staphylococcus aureus 502A: CH52_13345Help
Entry
CH52_13345        CDS       T03491                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
saud  Staphylococcus aureus 502A
Pathway
saud00471  D-Glutamine and D-glutamate metabolism
saud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saud00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CH52_13345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saud01011]
    CH52_13345
Enzymes [BR:saud01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CH52_13345
Peptidoglycan biosynthesis and degradation proteins [BR:saud01011]
 Precursor biosynthesis
  Racemase
   CH52_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AHM71229
UniProt: W8TX37
Structure
PDB: 

Position
complement(2758887..2759687)
Genome map
AA seq 266 aa AA seqDB search
MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKL
MEFDIKMLVIACNTATAVALEYLQKTLSIPVIGVIEPGARTAIMTTRNQNVLVLGTEGTI
KSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTITSIVIHQTLKRWRNSESDTV
ILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATG
DPTHITNIIKEWLNLSVNVERISVND
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccaataggtgtaatagactctggtgtcggaggtttgacagtagctaaagaa
attatgcgtcagttgccaaatgagacgatttattacttaggtgatattggacgatgtcca
tatgggccaagaccaggagaacaagtaaaacaatatacagttgaaatcgctcgtaaatta
atggaatttgatataaaaatgctcgtgattgcttgtaatacagcaactgctgtagcttta
gaatatttacaaaagaccttatcaatcccagtgattggtgtaattgaaccaggtgctaga
acagcaataatgactactagaaatcaaaatgtattagtactaggaactgaaggcacaatt
aaatctgaagcatatcgtacgcatattaaacgtatcaatccacatgtagaggtacatggc
gttgcctgtccaggttttgtgccacttgtagaacaaatgagatatagtgatccaacaatt
acaagcattgtcattcatcaaacactgaaacgttggcgtaatagtgagtctgatactgtc
attttaggatgtacccactatccattgctctataaacctatctatgattattttggtggt
aaaaagacagtgatttcgtctggattagaaacggctcgtgaagttagtgcattgctaaca
tttagtaatgaacatgcaagttatactgaacatccagatcatcgattttttgcaacaggt
gatcctactcacattactaacattatcaaagagtggttaaatttatctgtcaatgtggaa
cgtatatcagtgaatgactag

DBGET integrated database retrieval system