KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_000299Help
Entry
RSAU_000299       CDS       T02825                                 

Definition
(GenBank) acetyl-CoA acetyltransferase, putative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Pathway
saue00071  Fatty acid degradation
saue00072  Synthesis and degradation of ketone bodies
saue00280  Valine, leucine and isoleucine degradation
saue00310  Lysine degradation
saue00362  Benzoate degradation
saue00380  Tryptophan metabolism
saue00620  Pyruvate metabolism
saue00630  Glyoxylate and dicarboxylate metabolism
saue00640  Propanoate metabolism
saue00650  Butanoate metabolism
saue00900  Terpenoid backbone biosynthesis
saue01100  Metabolic pathways
saue01110  Biosynthesis of secondary metabolites
saue01120  Microbial metabolism in diverse environments
saue01130  Biosynthesis of antibiotics
saue01200  Carbon metabolism
saue01212  Fatty acid metabolism
saue02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSAU_000299
   00630 Glyoxylate and dicarboxylate metabolism
    RSAU_000299
   00640 Propanoate metabolism
    RSAU_000299
   00650 Butanoate metabolism
    RSAU_000299
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSAU_000299
   00072 Synthesis and degradation of ketone bodies
    RSAU_000299
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSAU_000299
   00310 Lysine degradation
    RSAU_000299
   00380 Tryptophan metabolism
    RSAU_000299
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSAU_000299
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSAU_000299
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSAU_000299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saue04147]
    RSAU_000299
Enzymes [BR:saue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSAU_000299
Exosome [BR:saue04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSAU_000299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt BsuBI_PstI_RE
Motif
Other DBs
NCBI-ProteinID: AGU54171
Position
345964..347145
Genome map
AA seq 393 aa AA seqDB search
MTKVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEINEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQQKAVRAQQNGEFDSEIVPVSIPQRKGESIVVTMDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattaatgaagtcatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcaa
tcaccaatgcttgtcaacaacagtcgctttggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagaacaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacaaaaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaatcaatcgttgtcactatggatgaaggtgta
cgtgaaaatgtatcagttgaaaaattaagtcgcttaagaccagctttcaaaaaagacggt
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggtgtagatccttctattatgggtattgcaccagttggcgctgttgaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaatcattagctgtagatcgcgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagtcgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system