KEGG   Staphylococcus aureus subsp. aureus 6850 (MSSA): RSAU_001788Help
Entry
RSAU_001788       CDS       T02825                                 

Gene name
gatC1
Definition
(GenBank) aspartyl/glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
saue  Staphylococcus aureus subsp. aureus 6850 (MSSA)
Pathway
saue00970  Aminoacyl-tRNA biosynthesis
saue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saue00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RSAU_001788 (gatC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:saue03029]
    RSAU_001788 (gatC1)
Enzymes [BR:saue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RSAU_001788 (gatC1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RSAU_001788 (gatC1)
Mitochondrial biogenesis [BR:saue03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RSAU_001788 (gatC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AGU55566
Structure
PDB: 

Position
complement(1913834..1914136)
Genome map
AA seq 100 aa AA seqDB search
MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQ
NVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaacacgtgaagaagttgagcatatcgcgaatcttgcaagacttcaaatt
tctcctgaagaaacggaagaaatggccaacacattagaaagcattttagattttgcaaaa
caaaatgatagcgctgatacagaaggcgttgaacctacatatcacgttttagatttacaa
aacgttttacgtgaagataaagcaattaaaggtattccgcaagaattagctttgaaaaat
gccaaagaaacagaagatggacaatttaaagtgcctacaatcatgaatgaggaggacgcg
taa

DBGET integrated database retrieval system