KEGG   Staphylococcus aureus subsp. aureus FDAARGOS_5: X998_0202Help
Entry
X998_0202         CDS       T03492                                 

Gene name
pflA
Definition
(GenBank) pyruvate formate-lyase-activating enzyme
  KO
K04069  pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
sauf  Staphylococcus aureus subsp. aureus FDAARGOS_5
Brite
KEGG Orthology (KO) [BR:sauf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    X998_0202 (pflA)
Enzymes [BR:sauf01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     X998_0202 (pflA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-ProteinID: AHW67585
UniProt: A0A0D1EST2
Position
complement(2141671..2142426)
Genome map
AA seq 251 aa AA seqDB search
MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
VNFKGKIPVEL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagggacacttacattctgtcgaaagtttaggtactgtcgatggaccgggatta
agatatatattatttacacaaggatgcttacttagatgcttgtattgccacaatccagat
acttggaaaattagtgagccatcaagagaagtcacagttgatgaaatggtgaatgaaata
ttaccatacaaaccatactttgatgcatcgggtggcggtgtaacagtcagtggtggcgaa
ccattgttacaaatgccattcttagaaaaattatttgcagaattaaaagaaaatggtgtg
cacacttgcttagacacatcggctggatgtgctaatgatacaaaagcatttcaaaggcat
tttgaagaattacaaaaacatacagacttgatattattagatataaaacatattgataat
gacaaacatattagattgacaggaaagcctaatacacacatccttaacttcgcgcgcaaa
ctgtcagatatgaaacaacctgtatggattcgacatgtccttgtgcctggttattctgat
gataaagacgatttaattaaactaggggaatttattaattctcttgataacgtcgaaaag
tttgaaattctgccatatcatcagttaggtgttcataagtggaaaacattgggcattgca
tatgaattagaagatgtcgaagcgcccgatgatgaagctgttaaagcagcctaccgttat
gttaacttcaaagggaaaattcccgttgaattataa

DBGET integrated database retrieval system